... L- lactateoxidaseQuátrìnhtinhprotein L- lactateoxidasetừchủngEcolitáitổhợptiếnhànhquabước sau: - Phá tế bào siêu âm đệm (50 mM Tris/Cl, pH 8.5; mM EDTA; 100 mM NaCl; 0.1 mM DTE; mM ... liệu http://www.lrc-tnu.edu.vn/ - Phân l p tuyển chọn chủng vi khuẩn lactic sinh tổng hợp L- lactateoxidase - Tách dòng gen L- lactateoxidasetừchủng vi khuẩn tuyển chọn - Táitổhợp gen L- lactate ... chủngtáitổhợp Glucose yếu tố điều hòa trình biểu L- lactate oxidase, việc khảo sát ảnh hưởng nồng độ glucose đến trình biểu L- lactateoxidase tế bào Ecoli BL21(DE3) cần thiết Chủngtáitổ hợp...
... clones with desired insert were selected The partial 16s rRNA of strain 731 was sequenced and dendrogram of its phylogeny was constructed From received results, this strain was identified to species ... the sensitivity of progressive multiple sequence alignment through sequence weighting, position - specific gap penalties & weight matrix choice Nucl acids Res 22 (1994) 4673-4680 Summary Cloning ... further experiments Extracted total genomic DNA of strain 731 was used as template for PCR reaction to amplify 16s rRNA gene fragment The PCR product of 0.5 kb was cloned into TM vector and DNA clones...
... SacI HaeIII Cắt đầu HpaI ScaI Escherichia coli Bacillus amiloliquefaciens Norcadio otitidis-caviarum Streptomyces achromogenes Haemophilus aegyptius Haemophilus paraipluenzae Streptomyces caespitosus ... coli) Các véctơ thoi chép Ecoli tế bào khác, chẳng hạn eukaryote - Các véctơ thoi đặc biệt có hiệu nghiên cứu đặc tính gen đồng thời prokaryote (vd E coli) eukaryote (vd Saccharomyces cerevisiae) ... để tạo dideoxyribonucleotite (ddNTP) Khi ddNTP gắn vào chuỗi tổng hợp thỉ trình tổng hợp dừng l i Giải trìnhtự đoạn ADN tách dòng Đánh dấu phóng xạ Mồi oligonucleotide + ADN polymerase, dATP,...
... gia enzym phiên mã ngược (reverse transcriptase enzyme), enzym DNA polymerase để tổng hợp cDNA (cDNA complêmntary DNA) Thuỷ phân sợi khuôn mRNA enzym RNase H, sau bổ sung enzym DNA polymerase dNTP ... nấm men sử dụng phương pháp biến nạp xung điện, bán gen… Bước 4: Sàng l c dòng táitổhợp Sàng long (screeing) thể táitổhợp nhằm chọn l c tế bào mang vectơ táitổhợp quần thể Tuỳ thuộc gen thị ... gen thị (marker) vectơ táitổhợp thị kháng sinh, thị màu để l a chọn phương pháp thích hợpBước 5: Nuôi cấy dòng táitổhợp thu sinh khối proteintáitổhợp Nuôi cấy dòng táitổhợp môi trường...
... photphodieste (enzym giới hạn, enzym Mungbean nuclease) Các enzym nối khung phân tử DNA (E coli ligase, T4 DNA ligase, T4 RNA ligase) Các enzym bổ sung loại nhóm phosphate Các enzym tổng hợp mối liên ... thích hợp với tế bào vật chủ Có vị trí gắn phân tử DNA ngoại lai (polycloning site) 3.Tạo DNA táitổhợp (Vector táitổ hợp) Việc tạo DNA táitổhợp cách ghép DNA l vào vector cắt enzyme cắt ... kết phosphodieste phân tử DNA (DNA polymerase, Reverse transcriptase) Các enzyme tham gia bảo vệ, phân giải, xoắn giãn xoắn DNA (methylase) A-Enzym cắt giới hạn (RE) • Enzym giới hạn enzym có khả...
... Base pair – Cặp Base Bt Bacillus thuringiensis dH2O Deion water – Nước khử ion DNA Deoxyribonucleotide acid – Axit Nucleic ĐC Đối chứngEcoli Escherichia coli h Giờ kDa Kilo Dalton OD Optical ... darmstadiensis, galleriae kenyae, darmstadiensis, tolworthi aizawai galleriae kurstaki Hình hộp 73 Không xác 74 định tenebrionis (san diego), morrisoni tolworthi kyushuensis L ỡng tháp israelensis, ... tố có trọng l ợng 25-30 kDa Các độc tố Cyt phát chủ yếu thuộc loài Bacillus thuringiensis israelensis, morrisoni, medellin, neolonensis, kyushuensis, damstradiensis, fuokukaensis, tenebrionis 1.1.8.5...
... chương trình ClustalW Chạy chương trình ClustalW Chạy chương trình ClustalW Tìm vùng bảo thủ theo protein Tìm vùng bảo thủ theo protein Tìm đoạn bảo thủ để tách dòng gen Chọn chủngsau tìm ... đặc tính gen công bố cấu trúc gen Các cấu trúc khác thường công bố phần nhỏ gen cung cấp Kết đặc tính gen chọn Z22920.1 hoạt tính peroxidase, được công bố l mRNA của chủng S.polyrrhiza ... dòng Chạy NEB Chọn vector tách dòng pet Chọn Enzyme giới hạn EcoRI :GAATTC SacI :GAGCTC Thiết kế vector tách dòng Thiết kế vector tách dòng Cặp mồi l a chọn GAATTCGCCTTTAGTATCATTCTC ...
... từchủng E. coli BL21(DE3)(mẫu 1) Dòng 2: Protein tổng số chứa đựng protein PRSVN PRSV Việt Nam tách từchủngEcoli BL21(DE3) Dòng 3: Protein tổng số đối chứng âm tách từchủng E. coli BL21(DE3)(mẫu ... H2O Dung dịch hỗn hợp acrylamide Dung dịch đệm gel cô Ammonium persulfate TEMED Nồng độ gel 5% (3ml/gel) 1,80ml 0,40ml 0,75ml 30 l 3 l Đổ hỗn hợp vào khuôn gel bên gel tách, đặt l c tránh tạo bọt ... EGVRNDYGLSDNEMQVMLNGLMVWCIENGTSPDISGVWVMMDGETQVDYPIKPLIEHATP SFRQIMAHFSNAAEAYIAKRNATERYMPRYGIKRNLTDISLARYAFDFYEVNSKTPDGAR EAHMQMKAAALRNTSRRMFGMDGSVSNKEENTERHTVEDVNRDMHSLLGMRN.ILALVCL EL 60 120 180 240 300 302 Trìnhtự nucleotide gen...
... SWFREC (2005), Cultural Control of the Whitefly/Geminiviruses Complex in Tomato, http://www.imok.ufl.edu/entlab/pres/whitefly/w_fly1a.jpg 35 The Phytoplasm genome project, Rolling circle replication ... Kochieva E. Z., Ryzhova N.N., Khrapalova I.A., Pukhalskyi V.A (2000), Genetic Diversity ADN Phylogenetic Relationships in the Genus Lycopersicon (Tourn.) Mill as Revealed by Inter-Simple Sequence ... Repeat (ISSR) Analysis, Russian Journal of Genetics, 8, pp 958-966 22 Laboratorio Integrato di Biologia Cellulare, Molecolare Immunologia, Http://cwx.prenhall.com/horton/medialib/media_portfolio/text_images/fg23_02.jpg...
... Monografia de la familie Caricaceae, Addocciation de Profesores, Universidad Central de Venezuela, Maracay, Venezuela 36 15 Baddillo V.M (2002), Carica L vs Vasconcella St (Caricaceae) la Rehabilitaction ... Ehrenfeld N., Romano E. , Serrano C., Arce-Johnson P (2004), Replicase mediated resistance against potato leafroll virus in potato Desiree plants, Biol Res, 37(1), pp 71-82 22 Fellers J., Collins ... (1997), Efficient transcription of the tRNA-like structure of turnip yellow mosaic virus by a template-dependent and specific viral RNA polymerase obtained by a new procedure, J Virol Methods,...
... từchủng E. coli BL21(DE3)(mẫu 1) Dòng 2: Protein tổng số chứa đựng protein PRSVN PRSV Việt Nam tách từchủngEcoli BL21(DE3) Dòng 3: Protein tổng số đối chứng âm tách từchủng E. coli BL21(DE3)(mẫu ... H2O Dung dịch hỗn hợp acrylamide Dung dịch đệm gel cô Ammonium persulfate TEMED Nồng độ gel 5% (3ml/gel) 1,80ml 0,40ml 0,75ml 30 l 3 l Đổ hỗn hợp vào khuôn gel bên gel tách, đặt l c tránh tạo bọt ... vào Vector táitổhợp pRSET đợc chuyển vào Ecoli TOP 10F để nhân dòng trì Muốn biểu proteintáitổhợp cấu trúc vector phải đợc chuyển 14 vào Ecoli BL21 (DE3) chủngEcoli biểu T7 polymerase dới...
... SWFREC (2005), Cultural Control of the Whitefly/Geminiviruses Complex in Tomato, http://www.imok.ufl.edu/entlab/pres/whitefly/w_fly1a.jpg 35 The Phytoplasm genome project, Rolling circle replication ... Kochieva E. Z., Ryzhova N.N., Khrapalova I.A., Pukhalskyi V.A (2000), Genetic Diversity ADN Phylogenetic Relationships in the Genus Lycopersicon (Tourn.) Mill as Revealed by Inter-Simple Sequence ... Repeat (ISSR) Analysis, Russian Journal of Genetics, 8, pp 958-966 22 Laboratorio Integrato di Biologia Cellulare, Molecolare Immunologia, Http://cwx.prenhall.com/horton/medialib/media_portfolio/text_images/fg23_02.jpg...
... khác Các phân tử ADN táitổhợpl m thay đổi mức độ biểu bình thường gen (chẳng hạn việc dung hợptrìnhtự mã hóa loài với trìnhtự promoter loài khác) chí mã hóa tổng hợp loại protein “dung hợp ... (cADN) Quátrình gọi trình phiên mã ngược thực nhờ enzym ADN polymerase đặc biệt reverse transcriptase Enzym có khả tổng hợp ADN bắt nguồn từ phân tử ARN mạch đơn l m khuôn ban đầu Khi có mặt enzym ... mặt enzym reverse transcriptase, trìnhtự mARN phiên mã ngược thành phân tử ADN sợi kép, phân tử gắn vào véctơ Để phân l p đoạn cài riêng rẽ từ thư viện hệ gen, tế bào Ecolitiếnhành biến nạp...
... diamin tetra-acetic acid EtBr Ethidium bromide PCR Polymerase Chain Reaction SDS Sodium dodecyl sulphate TAE Tris – Acetate –EDTA Taq Polymerase Polymerase Thermus aquaticus TBE Tris – Base –EDTA ... * N-demethylation * Ketoreduction keto deoxyglucose OdTDP C2 * Deoxygeneration * O-methylation Sơ đồ 3: Con đường chung mô tả chế sinh tổng hợp đuờng deoxyhexose từ glucose-1-phosphate, Các vị ... tự gen ta tiếnhành tách plasmid táitổhợp pGEMnovS tế bào vi khuẩn E. coli XL1 Blue biến nạp trên, sau gửi giải trìnhtự 2.2.8 Tạo vector táitổhợp pET -32 a(+) Đoạn gen sau giải trìnhtự xác...
... Nội Chƣơng 1: TỔNG QUAN TÀI LIỆU THỤ THỂ LIÊN KẾT VỚI G PROTEIN 1.1 1.1.1 G protein G proteinl n phát mô tả Alfred Martin hai ông nghiên cứu tác động adrenaline tế bào Với công trình này, hai ... di, l a chọn hai khuẩn l c 11A 5E Các vector táitổhợp hai khuẩn l c kí hiệu pCDNA3-NK1-11 pEGFP-N1-NK1-5 Chúng tách chiết hai loại plasmid táitổhợp để giải trìnhtự 3.2.3 Giải trình tự gen ... plasmid táitổhợp Plasmid kí hiệu pNK1-3 Plasmid pNK1-3 giải trìnhtự hai chiều mồi vector pJET 1.2 F/ R Kết trình bày Phụ l c Kết so sánh với trìnhtự nucleotide cDNA mã hóa cho thụ thể neurokinin-1...