transcending of bodily existence as a question of medical ethics in an intercultural context

Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt

Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt

Ngày tải lên : 29/03/2014, 00:20
... 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA 74:LAGAAGVAIPLIGRNRRFLQTDGSLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPEFPWKKFPFPGFFA ... increase in manganese accumulation (Fig 5B) The strain expressing DN36 had an increased zinc content and measurement of the 65Zn uptake of cells showed that the 65Zn accumulation of cells expressing ... complementary Mn2+ uptake (Fig 5A) Manganese accumulation of an smf1 strain expressing TjZNT2 was significantly higher than that of the vector control cells, whereas a strain expressing DN36 showed no increase...
  • 8
  • 343
  • 0
Tài liệu mẫu phân tích IPA  Importance   performance analysis as a strategic tool for destination attractiveness an analysis of domestic

Tài liệu mẫu phân tích IPA Importance performance analysis as a strategic tool for destination attractiveness an analysis of domestic

Ngày tải lên : 01/08/2014, 10:25
... m b s c o m [39] Bindu Narayanan, Chandrasekharan Rajendran, Prakash Saia, L, Ram Gopalan,“Dimensions of service quality in tourism – an Indian perspective”, Total Quality Management, Vol 20, ... scholars in various fields in the area of management Organization behavior Bindu.T holds an MBA in Marketing and HR from Bharathiar University, and M.Phil in Marketing from Avinashlingam University, ... meeting locals and learning a local recipe These destination attraction attributes having low importance rating and a low performance rating suggest that investing resources to these areas may offer...
  • 7
  • 874
  • 3
Báo cáo khoa học: "Bioavailability of the amino acid-attached prodrug as a new anti-HIV agent in rats" pdf

Báo cáo khoa học: "Bioavailability of the amino acid-attached prodrug as a new anti-HIV agent in rats" pdf

Ngày tải lên : 07/08/2014, 23:22
... htob erusaem ot desu saw )ASU ,tneligA( nevo nmuloc a dna ,)ASU ,tneligA( relpmasotua na ,)ASU ,tneligA( ressaged a ,)ASU ,tneligA( pmup a ,)ASU ,tneligA( rotceted VU yarra edoidotohp a gnidulcni ... LA1050-PV rof alumrof eninala dica onima eht yb ytilibaliavaoib fo tnemevorpmi ehT etadidnac gurdorp wen a rof yrotcafsitas erew amsalp ni noitartnecnoc fo ecnanetniam eht dna ,mrof evitca na ... noitartsinimda suonevartni retfa 2050-PV fo sretemarap citenikocamrahP elba T 562 star ni tnega VIH-itna wen a sa gurdorp dehcatta-dica onima eht fo ytilibaliavaoiB nwohs sah ,siht ot roirp demrofrep...
  • 5
  • 211
  • 0
báo cáo khoa học: "DNA aneuploidy as a topographic malignant transformation pattern in a pleomorphic adenoma of long-term evolution: a case report" docx

báo cáo khoa học: "DNA aneuploidy as a topographic malignant transformation pattern in a pleomorphic adenoma of long-term evolution: a case report" docx

Ngày tải lên : 10/08/2014, 22:20
... immunohistochemical diagnosis and photographs AS performed and evaluated the cytometry analysis TC reviewed and corrected the manuscript and grammar All authors read and approved the final manuscript Page of ... superficial areas (groups and 2) (A) Hematoxylin and eosin staining showing cords and islands of polygonal cells without atypia in a myxoid stroma (200× magnification) (B) Basal and myoepithelial cells ... Criteria for malignancy include invasiveness, cellular anaplasia or pleomorphism, atypical mitosis and abnormal architectural patterns [1,3] It is currently postulated that malignant transformation...
  • 7
  • 337
  • 0
Báo cáo y học: " Breast conserving surgery with preservation of the nipple-areola complex as a feasible and safe approach in male breast cancer: a case report" pptx

Báo cáo y học: " Breast conserving surgery with preservation of the nipple-areola complex as a feasible and safe approach in male breast cancer: a case report" pptx

Ngày tải lên : 11/08/2014, 23:21
... Abbreviations ANC: axillary node clearance; BCS: breast conserving surgery; DCIS: ductal carcinoma in situ; FBC: female breast cancer; FNA: fine needle aspiration; IDC: invasive ductal carcinoma; ... initial manuscript DJH performed the initial operation, and organised the primary management plan of the patient He supervised the writing and editing of the paper All the authors have read and ... excision in primary operable invasive breast cancer Eur J Cancer 1995, 3 1A: 2191-2195 Giordano SH, Cohen DS, Buzdar AU, Perkins G, Hortobagyi GN: Breast carcinoma in men: a population-based study Cancer...
  • 3
  • 275
  • 0
Báo cáo y học: " Use of cracked maize as a carrier for NDV4 vaccine in experimental vaccination of chickens" pot

Báo cáo y học: " Use of cracked maize as a carrier for NDV4 vaccine in experimental vaccination of chickens" pot

Ngày tải lên : 12/08/2014, 04:20
... the various analyses, including data collection and statistical analysis GE participated in the study coordination ON participated in data collection AC contributed in data analysis All authors ... portable water and maintenance feed One gram of each V4 virus coated maize grain samples, were kept into a sterile McCartney bottle and 10.0 ml of PBS containing antibiotics, was ascetically added, ... be a steady rise in the antibody titre as the number of days of repeat vaccination increases Applying the Multiple Range Test (MRT), it was observed that the various parts of grain Olabode et al...
  • 5
  • 285
  • 0
Báo cáo y học: "Lung epithelium as a sentinel and effector system in pneumonia – molecular mechanisms of pathogen " pdf

Báo cáo y học: "Lung epithelium as a sentinel and effector system in pneumonia – molecular mechanisms of pathogen " pdf

Ngày tải lên : 12/08/2014, 16:20
... resistant bacteria, and the emergence of new pulmonary pathogens into account, an exact analysis of molecular mechanisms of disease is mandatory to form a rational basis for the development of innovative ... proteins, contains NALP (NACHT-, LRR-, and pyrin domaincontaining proteins), NOD (nucleotide-binding oligomerization domain), CIITA (class II transactivator), IPAF (ICE-protease activating factor) ... central NOD (NACHT) domain exhibits ATPase activity and facilitates self-oligomerization An amino-terminal localized caspase-recruitment domain (CARD) (one CARD domain in NOD1, two in NOD2) mediates...
  • 17
  • 287
  • 0
Báo cáo khoa học: "Tumor slices as a model to evaluate doxorubicin in vitro treatment and expression of trios of genes PRSS11, MTSS1, CLPTM1 and PRSS11, MTSS1, SMYD2 in canine mammary gland cancer" pptx

Báo cáo khoa học: "Tumor slices as a model to evaluate doxorubicin in vitro treatment and expression of trios of genes PRSS11, MTSS1, CLPTM1 and PRSS11, MTSS1, SMYD2 in canine mammary gland cancer" pptx

Ngày tải lên : 12/08/2014, 18:22
... Acta Veterinaria Scandinavica 2008, 50:27 Introduction Human and canine malignant mammary tumors share some epidemiological and clinicopathological features Incidence in both species increases ... cancer is associated with the same survival benefit as adjuvant chemotherapy and offers the advantage of an increased likelihood of breast conservation Many drug regimens have been used for a ... Veterinaria Scandinavica 2008, 50:27 http://www.actavetscand.com/content/50/1/27 Patients were evaluated by clinical history and physical examination including mammary tumor measurement and inguinal...
  • 9
  • 337
  • 0
Development and validation of classroom assessment literacy scales english as a foreign language (EFL) instructors in a cambodian higher education setting

Development and validation of classroom assessment literacy scales english as a foreign language (EFL) instructors in a cambodian higher education setting

Ngày tải lên : 04/12/2015, 14:04
... memorising facts and details of the learning materials to handle the assessment tasks) rather than using a deep learning approach (i.e., understanding, integrating and relating the learning materials ... proficiency (Neau, 2003; Clayton, 2008; Howes & Ford, 2011) The last phase was the integration of Cambodia into the Association of Southeast Asian Nations (ASEAN) Becoming a member of ASEAN, the need ... act as agents in the assessment process, linking assessment and learning Others (Lamprianou & Athanasou, 2009; Chappuis et al., 2012; Popham, 2014) have argued for “assessment for learning” and...
  • 326
  • 732
  • 0
Báo cáo y học: "The characterisation of mucin in a mature ovarian teratoma occurring in an eight year old patient

Báo cáo y học: "The characterisation of mucin in a mature ovarian teratoma occurring in an eight year old patient

Ngày tải lên : 26/10/2012, 10:03
... site of secretion and whether the organ is in a normal or diseased state As far as we know this is the first time an amino acid analysis has been done of purified mucin in an ovarian teratoma The ... the gastric mucin M1 antigens reacted to monoclonal antibodies obtained against mucins isolated from a human ovarian mucinous cyst These monoclonal antibodies exclusively stained the surface gastric ... high amounts of ‘mucin-like amino acids, serine, threonine and proline Serine and threonine are points of O-glycosylation found in the tandem repeat regions of mucins and their ratios can vary...
  • 9
  • 549
  • 0
Tài liệu Báo cáo khoa học: Diversity and junction residues as hotspots of binding energy in an antibody neutralizing the dengue virus doc

Tài liệu Báo cáo khoa học: Diversity and junction residues as hotspots of binding energy in an antibody neutralizing the dengue virus doc

Ngày tải lên : 19/02/2014, 07:20
... phase, and calculated as the ratio of two rate constants However, values of DDG and DDG¢ for mutant Fab fragments, calculated from values of KD and KD¢, respectively (Table 1), can be compared ... directed against mouse Fab and conjugated with alkaline phosphatase The total concentration of MalE-E3-H6 in the binding reaction is given along the x axis, and the optical signal A4 05 in the indirect ... by mutagenesis of their residues into alanine (Ala scanning) The affinities of the purified mutant Fab fragments of mAb4E11 for its antigen were measured by a competition ELISA in solution, and their...
  • 13
  • 658
  • 0
The Future of Medical Education in Canada (FMEC): A Collective Vision for MD Education ppt

The Future of Medical Education in Canada (FMEC): A Collective Vision for MD Education ppt

Ngày tải lên : 14/03/2014, 20:20
... Martin Associate Dean Undergraduate Medical Education Faculty of Medicine University of Manitoba Catherine Moffatt Project Manager The Association of Faculties of Medicine of Canada (AFMC) Alan ... Representing The Royal College of Physicians and Surgeons of Canada (RCPSC) Physician Risk Manager Medical Trainee Program Canadian Medical Protective Association (CMPA) Angela Towle Associate Dean ... of Faculties of Medicine of Canada (AFMC) Project Staff Catherine Moffatt Project Manager The Association of Faculties of Medicine of Canada (AFMC) Claire de Lucovich Project Assistant The Association...
  • 54
  • 419
  • 1
báo cáo sinh học:" Burnout and training satisfaction of medical residents in Greece: will the European Work Time Directive make a difference?" pot

báo cáo sinh học:" Burnout and training satisfaction of medical residents in Greece: will the European Work Time Directive make a difference?" pot

Ngày tải lên : 18/06/2014, 17:20
... CP, Tan AD, Habermann TM, Sloan JA, Shanafelt TD: Association of resident fatigue and distress with perceived medical errors Jama 2009, 302:1294-1300 Mossialos E, Allin S, Davaki K: Analysing ... (Spearman rank correlations, KruskalWallis one-way analyses of variance and Mann-Whitney U tests, all P-values > 0.05) Due to Greek hospitals varying in specialties for residency training they offer, ... sector and by certain public insurance organizations, including the National Foundation for Social Insurance (IKA), which function as bilateral monopolies similarly to the U.S .A Health Maintenance...
  • 11
  • 380
  • 0
báo cáo sinh học:" Profile and professional expectations of medical students in Mozambique: a longitudinal study" doc

báo cáo sinh học:" Profile and professional expectations of medical students in Mozambique: a longitudinal study" doc

Ngày tải lên : 18/06/2014, 17:20
... not have any opinion Regarding the quality of the training received 52% felt it was adequate or very adequate, and 20% that it was inadequate or very inadequate and the balance did not have any ... Pre -Medical Academic Performance as predictor of Performance in the Medical School: A case study at the College of Medicine of the University of Lagos Nigerian Journal of Health and Biomedical ... Salahdeen HM, Murtala BA: Relationship between Admission Grades and Performances of Students in the First Professional Examination in a New Medical School African Journal of Biomedical Research...
  • 4
  • 475
  • 0
báo cáo hóa học:" Functional bracing for delayed union of a femur fracture associated with Paget''''s disease of the bone in an Asian patient: a case report" pot

báo cáo hóa học:" Functional bracing for delayed union of a femur fracture associated with Paget''''s disease of the bone in an Asian patient: a case report" pot

Ngày tải lên : 20/06/2014, 04:20
... disease in Australia, New Zealand, North America and most European countries, but it has a low incidence in Scandinavia, and is extremely rare in the Japanese population, with a prevalence of ... as: Takigami et al., Functional bracing for delayed union of a femur fracture associated with Paget's disease of the bone in an Asian patient: a case report Journal of Orthopaedic Surgery and ... fracture site, allowing vascular regeneration and eliminating further damage to the peripheral and intramedullary blood supply which occurs during plate and screw fixation and intramedullary nailing...
  • 4
  • 402
  • 0
báo cáo khoa học: "Complications of Evans'''' syndrome in an infant with hereditary spherocytosis: a case report" pdf

báo cáo khoa học: "Complications of Evans'''' syndrome in an infant with hereditary spherocytosis: a case report" pdf

Ngày tải lên : 10/08/2014, 22:20
... of the clinical management of the patient, acquisition of data, drafting the manuscript; HI was supervisor of clinical management of the patient and interpretation of data; TY, TI, AM were responsible ... responsible of discussion and editing of the manuscript; TO was principal investigator of erythrocyte binding IgG quantitative analysis; MK was principal investigator of platelet specific autoantibodies ... blood transfusion [12] Another report showed presence of both an anti-protein 4.2 antibody and other undefined autoantibodies against RBC associated with heavy transfusions in protein 4.2-negative...
  • 4
  • 341
  • 0
báo cáo khoa học: " Beneficial effects of physical activity in an HIVinfected woman with lipodystrophy: a case report" ppsx

báo cáo khoa học: " Beneficial effects of physical activity in an HIVinfected woman with lipodystrophy: a case report" ppsx

Ngày tải lên : 10/08/2014, 23:20
... concerns about a loss of muscle mass She was clinically Page of diagnosed as having lipoatrophy of the upper and lower limbs She showed increased dissatisfaction with her appearance during her next medical ... Regular exercise training improved physical fitness and was effective and safe in mitigating changes associated with lipodystrophy and dyslipidemia in a woman infected with HIV These preliminary ... my health and it is very important to maintain it I noted that it greatly improved my body; my paunch has decreased in size but I still want more I think the main change was the increase in my...
  • 6
  • 445
  • 0
báo cáo khoa học: "Compound double ileoileal and ileocecocolic intussusception caused by lipoma of the ileum in an adult patient: A case report" ppt

báo cáo khoa học: "Compound double ileoileal and ileocecocolic intussusception caused by lipoma of the ileum in an adult patient: A case report" ppt

Ngày tải lên : 10/08/2014, 23:20
... A barium enema image of the colon shows a filling defect in the ascendant colon (arrows) Page of Figure An abdominal computed tomography scan shows a ‘sausage’-shape soft-tissue mass in the ascendant ... intussusception in adults is surgical because of the high incidence of underlying malignant pathology and serious complications that can develop as a result of intestinal obstruction and vascular strangulation ... colon were invaginated Because of compromised perfusion and swelling of his colonic wall and because of an unsuccessful attempt at manual desinvagination, a round incision in his ascending colon...
  • 5
  • 371
  • 0
Báo cáo y học: "Calcified amorphous tumor of the heart in an adult female: a case report" potx

Báo cáo y học: "Calcified amorphous tumor of the heart in an adult female: a case report" potx

Ngày tải lên : 11/08/2014, 03:21
... are atrial myxomas [1] However, not all cardiac masses are neoplasms; for instance intra-mural thrombi are great mimics of neoplasms [2,8] Regardless of the nature of a cardiac mass (neoplastic ... clinical presentation is similar to other cardiac tumors such as myxoma, surgical excision and histopathologic examination remains the mainstay of an accurate diagnosis Page of Lewin M, Nazarian ... Pathology, All India Institute of Medical Sciences, Ansari Nagar, New Delhi - 110029, India 2Department of Cardiothoracic and Vascular Surgery, All India Institute of Medical Sciences, Ansari Nagar, New...
  • 3
  • 316
  • 0
Báo cáo y học: "Calcified amorphous tumor of the heart in an adult female: a case report" docx

Báo cáo y học: "Calcified amorphous tumor of the heart in an adult female: a case report" docx

Ngày tải lên : 11/08/2014, 07:20
... are atrial myxomas [1] However, not all cardiac masses are neoplasms; for instance intra-mural thrombi are great mimics of neoplasms [2,8] Regardless of the nature of a cardiac mass (neoplastic ... clinical presentation is similar to other cardiac tumors such as myxoma, surgical excision and histopathologic examination remains the mainstay of an accurate diagnosis Page of Lewin M, Nazarian ... Pathology, All India Institute of Medical Sciences, Ansari Nagar, New Delhi - 110029, India 2Department of Cardiothoracic and Vascular Surgery, All India Institute of Medical Sciences, Ansari Nagar, New...
  • 3
  • 533
  • 0

Xem thêm