Báo cáo y học: " The Vpr protein from HIV-1: distinct roles along the viral life cycle" potx
Báo cáo Y học: Propionate CoA-transferase from Clostridium propionicum Cloning of the gene and identi®cation of glutamate 324 at the active site pdf
... (R.)-lactyl-CoA dehydra-tase from Clostridium propionicum. Stereochem istry of the dehy-dration of (R)-2-hydroxybutyryl-CoA to croton yl-CoA. Eur. J.Biochem. 206, 547±552.20. Kelley, L.A., ... lMpropionyl-CoA in the presence of either sodiumborohydride ( 20 mM) o r hydroxylamine (pH 7.5, 2 00 mM), the en zyme w as rapidly and irreversibly inactivated. The inactivation was strictly dependent ... borohydride o r h ydroxyl-amine in the presence of propionyl-CoA. The reduction of the t hiol ester between a catalytic site glutamate and Co Awith borohydride and the cleavage by hydroxylamine wereused...
- 9
- 498
- 0
Báo cáo y học: " Extracting key information from historical data to quantify the transmission dynamics of smallpox" doc
... countriesand finally in Brazil [1,31-33]. Variola minor accountedfor the majority of cases in the early 20th century in the United States, where it remained the only form of small-pox from the 1930s ... criterion in determining the virulenceof variola virus, the outcome of these laboratory studiesmay have been distorted by the vaccination history ofcases and maybe also by other factors. Epidemiologicalclarification ... carefully validated in earlier mathemat-ical modelling studies [16,17]. Accordingly, the policyimplications of these models differed widely, and thus the necessity arose to capture the basic...
- 12
- 368
- 0
Báo cáo y học: "Inhaled activated protein C: a new therapy for the prevention of ventilator-induced lung injury" docx
... volumes for acute lung injury and the acute respiratory distress syndrome. The Acute Respiratory Distress Syndrome Network. N Engl J Med 2000, 342:1301-1308.14. Yilmaz M, Keegan MT, Iscimen ... and also is likely to prevent the development of lung injury when used as the initial mode of ventilation [11-14]. erefore, the clinically relevant questions now become whether inhaled APC ... can diminish the severity of lung injury when used in conjunction with low-tidal-volume ventila-tion in the presence of acute lung injury due to sepsis or other etiologies and whether inhaled...
- 2
- 391
- 0
Báo cáo y học: " Promoter addresses: revelations from oligonucleotide profiling applied to the Escherichia coli genome" ppsx
... once in the database in a pro-tein-bound state. These results show the propensity of the genome to increase the protein- interacting capacity of the -100 region and hence increase the activity of ... density (different but relatedwords). The peak and the plateau together constitute the promoter. The plateau is formed by class III oligonucle-otides that have the capacity to bend DNA. The facilitatorsare ... frequencies. The occurrence of many of the enriched hexanucleotidesas protein- bound DNA complexes in the NDB database isindicative of their protein- interacting ability. This reflectson the protein...
- 9
- 256
- 0
Báo cáo y học: "Novel G-protein-coupled receptor-like proteins in the plant pathogenic fungus Magnaporthe grisea" pot
... MCNLQGMGLVFFLSSSYLWTMCISISLFMVFFTTIFE LNHWFKYFHFICWGIPLFTAIISL IFHAYGK TGS WCFISDBAA99285 : PCYLYSIVITYGSLSCWLWTLCLAISIYLMIVRRYPE PEKLERYYFFVCWGLPLISTIIML SKDLVHF LGN WCWIGEP13773(SP) : PCYLYAIVITYGSFACWLWTLCLAISIYMLIVKREPE ... PCYLYAIVITYGSFACWLWTLCLAISIYMLIVKREPE PERFEKYYYLLCWGLPLISTIVML AKNTVQF VGN WCWIGVP35352(SP) : QCYLYATVITYGSLACWLWTLCLSFSIYNLIVKREPE PEKFEKYYHVFCWVVPFIMSVIML SKGVIEV TGN WCWIGNQ9TX43(SP) : GSTSFQCYLYAITITYGSLACWLWTLCLAFSIYNLIVKREPE ... P13773(SP) : SFTGYRFGLFYGPFLFI : 78-171 P35352(SP) : TYVGYRFGLFYGPF : 89-179 Q9TX43(SP) : KYVGYRFGYIYGPFFAI : 74-172 P34907(SP) : NYDGYRFGLFYGPF : 75-167 CAD37067 : KWDIFRIATFYGPV : 88-186 NCU04626.1...
- 14
- 242
- 0
Báo cáo Y học: SF2/ASF protein inhibits camptothecin-induced DNA cleavage by human topoisomerase I potx
... On the other hand,an impaired DNA cleavage observed in the cleavage assayshould be reflected by inhibition of the reaction catalysed byhtopo I rather than by inhibition of the movement of the enzyme ... that either SF2/ASF prevents htopo I from binding to DNA or it impairs the reaction catalysed by the enzyme. The first mechanism has been revealed asunderlying the inhibition of camptothecin-induced ... and then was directly used in the cleavage assay.To phosphorylate SF2/ASF, htopo I and unlabeled 1 mMATP were used under the conditions of the kinase assay[9]. When the mixture was further...
- 7
- 361
- 0
Báo cáo y học: " Restriction by APOBEC3 proteins of endogenous retroviruses with an extracellular life cycle: ex vivo effects and in vivo "traces" on the murine IAPE and human HERV-K elements" pot
... displaying the highest homologyto their cognate probe were selected for the IAPE-D andHERV-K elements. Twenty sequences with the highesthomology to the IAPE-A sequence and localized on the Y Distribution ... extracellular life cyclehas been the progenitor of the IAP element, the restrictionobserved for IAP by mA3 appears simply to be the conse-quence of the restriction that initially controlled the pro-genitor ... byspecific APOBEC3 proteins during their retroviral cycle ofamplification and insertion into their target host genome.We further explored APOBEC3 editing by analyzing morespecifically the G-to-A substitutions...
- 11
- 277
- 0
Báo cáo y học: " GOTax: investigating biological processes and biochemical activities along the taxonomic tree" pot
... is the hypothetical protein Ycdx from Escherichia coli. It has been shown that the active site ofthis protein contains three zinc ions [22]. The putative func-tion of this domain is the hydrolysis ... the process 'stomatal complex morphogenesis'(GO:0010103) and the function 'cytokinin dehydrogenaseactivity' (GO:0019139). The most similar protein from yeast is the dihydrofolate ... similarity below 0.6 to any process from humanFigure 4Screenshot of the histogram showing the grouping of the biological processes from yeast with a semantic similarity below 0.6 to any process from...
- 10
- 205
- 0
Báo cáo y học: "Cyclophosphamide in systemic sclerosis: still in search of a ‘real life’ scenario" potx
... quality-adjusted life years (QALYs) versus a loss of 0.21 QALYs of the case base (disease duration of 1.5 years) and 0.44QALYs if started after 3 years from the diagnosis [9]. Thesedata clearly demonstrate ... and therefore the only way to lift the curtainon the role of CYC in ILD will derive from a trial on patientswith properly defined early and active SSc. The absence ofguidelines derived from ... occurred either with or without the development of new symptoms, mainly dyspnoea on exertion. The third fact is that the studies have focused their attentionon diffuse SSc patients only, whereas...
- 3
- 301
- 0
Báo cáo y học: "hnRNP E1 and E2 have distinct roles in modulating HIV-1 gene expression" pps
... the nascent transcript and polyadenylation). Theseprocessing events occur as the transcript is being synthe-sized, and each one is able to influence the efficiency andspecificity of the others ... from degradation by interactingwith the poly(A)-binding protein (PABP; [59-61]). Littleis known as to whether the different hnRNP E proteinshave unique functions or if they show redundancy ... hnRNP E1. Deletion of the C-terminal 148 amino acids from hnRNP E1 (mycE1ΔC)resulted in the redistribution of the protein from the nucleus to the cytoplasm. Removal of the C-terminal KHdomain...
- 18
- 292
- 0
Từ khóa: báo cáo y họcbáo cáo y học cổ truyềnmẫu báo cáo y học cổ truyềnbao cao y hoc colchicinphan ban luan trong bao cao y hoc co truyenbáo cáo khoa học y họcbáo cáo y tế học đườngmẫu báo cáo y tế học đườngbáo cáo y tế học đường cuối nămbáo cáo y tế học đường năm 2012báo cáo y tế học đường trường mầm nonbiểu mẫu báo cáo y tế trường họcbáo cáo giáo dục thể chất trường tiểu họcbáo cáo y tế học đường trường tiểu họcbáo cáo y tế trường tiểu họcBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Báo cáo quy trình mua hàng CT CP Công Nghệ NPVMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngThơ nôm tứ tuyệt trào phúng hồ xuân hươngThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXQuản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namMÔN TRUYỀN THÔNG MARKETING TÍCH HỢPTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ