Phân lập tuyển chọn các chủng corynebacterium glutamicum và tách dòng gen met a mã hoá enzym homoserine acetyltransferase sinh tổng hợp axit amin l methionin

Bộ giáo dục đào tạo Trường đại học bách khoa hà nội - ♣ - Luận văn thạc sĩ khoa học Ngành: Công nghệ sinh học “Phân lập, tuyển chọn chủng Corynebacterium glutamicum tách dòng gen Met A mã hoá enzym Homoserine Acetyltransferase sinh tổng hợp axit amin LMethionin” Nguyễn thị Hồng Hà hà nội, 2006 Bộ giáo dục đào tạo Trường đại học bách khoa hà nội - ♣ - Luận văn thạc sĩ khoa học “Phân lập, tuyển chọn chủng Corynebacterium glutamicum tách dịng gen Met A mã hố enzym Homoserine Acetyltransferase sinh tổng hợp axit amin L-Methionin” Ngành: Công nghệ sinh học Mã Số: Nguyễn thị Hồng Hà Người hướng dẫn khoa học: PGS.TS Nguyễn Thuỳ Châu hà nội, 2006 Mục lục Phần mở đầu Chương Tổng quan 1.1 Tình hình nghiên cứu sản xuất methionin giới Việt Nam 1.1.1 Trên giới 1.1.2 Việt Nam.5 1.2 Đại cương C glutamicum..6 1.2.1 Đặc điểm hình thái C glutamicum…………………………… 1.2.2 Vai trß cđa C glutamicum sinh tổng hợp axit amin.7 1.3 Công thức cấu tạo, tính chÊt L- methionin………………… ……… 1.4 C¥ chÕ Sinh tỉng hợp Axit amin 1.4.1 Sản xuất axit amin đường phân nhánh.11 1.4.2 Con đường sinh tổng hợp methionin từ nhánh homoserin 13 1.4.3 Thành phần môi trường điều kiện nuôi cấy cho sản lượng methionin cao.18 1.4.4 Tạo chủng đột biến để sản xuất methionin 20 1.4.5 Thu håi methionin tõ lªn men láng…………………………………21 1.5 Vai trò sinh học ứng dụng Methionin sèng………… 22 1.6 Sư dơng kü tht sinh häc ph©n tử để tăng sản lượng methionin24 1.6.1 Những nghiên cứu methionin mức độ phân tử vai trò met A đường sinh tổng hợp methionin 24 1.6.2 Vectơ sử dụng cho tách dòng 25 Chương Vật liệu phương pháp nghiên cứu 28 2.1 Đối tượng nghiên cứu 28 2.2 Vật liệu 28 2.3 Phương pháp nghiên cứu 30 2.3.1 Phương pháp thu thập mẫu30 2.3.2 Phương pháp phân lập chủng C glutamicum.30 2.3.3 Phương pháp phân loại chủng C.glutamicum.30 2.3.3.1 Đặc điểm hình thái tế bào.31 2.3.3.2 Xác định hoạt tính catalaza 31 2.3.3.3 Khả sinh khí CO 31 2.3.3.4 Xác định khả dịch hoá gelatin.32 2.3.3.5 Xác định khả khử NO-3 NO-2 32 2.3.3.6 Xác định khả tạo H S 32 2.3.4 Phương pháp lên men sinh tổng hợp L-methionin từ chủng C glutamicum đà phân lập 33 2.3.5 Phương pháp định tính bán định lượng L-methionin.33 2.3.5.1 Định lượng L-methionin phương pháp sắc ký giấy33 2.3.5.2 Định lượng L-methionin 34 2.3.6 Tách dòng đọc trình tự gen metA từ chủng C.glutamicum phân lập b»ng kü tht PCR……………………………………… …………….36 2.3.6.1 T¸ch chiÕt DNA hƯ gen cđa vi khn…………………….……… 36 2.3.6.2 Kü tht PCR nh©n b¶n gen metA …………………………….… 39 2.3.6.3 Ph¶n øng nèi ghÐp gen (tạo dòng đoạn DNA đặc hiệu gen metA) 39 2.3.6.4 Biến nạp sản phẩm ghép gen (plasmit tái tổ hợp) sốc nhiệt vào E coli DH5 40 2.3.6.5 T¸ch chiÕt DNA plasmit tõ E coli DH5α ……………… ……… 41 2.3.6.6 Xư lý DNA b»ng enzym giíi h¹n EcoRI .42 2.3.6.7 Tách tinh DNA plasmit lượng lớn. 42 2.3.6.8 Xác định trình tự nucleotit gen metA. 43 Chương Kết thảo luận 45 3.1 PHân lập TUYN CHN CHNG C Glutamicum SINH L-METHIONIN.45 3.1.1 Phân lập chủng vi khuẩn có khả sinh tổng hợp methionin từ đất tỉnh miền Bắc Việt Nam 45 3.1.2 Tuyển chọn chủng vi khuẩn có khả sinh tổng hợp L-methionin cao.46 3.1.3 nh loi vi khuẩn có khả sinh methionin da vo c im hình thái v tính cht sinh lý, sinh hóa 47 3.2 Tách Dòng xác định trình tự gen met A mà hoá Homoserin Acetyltransferaza tõ C glutamicum…………………………… ………49 3.2.1 Ph©n lËp gen metA .51 3.2.1.1 T¸ch chiÕt DNA hƯ gen cđa C glutamicum 51 2.1.2 Nh©n gen metA b»ng kü thuËt PCR .53 3.2.2 T¸ch dßng gen met A 54 3.2.2.1 Đưa gen vào vectơ tách dßng pCR 2.1 55 3.2.2.2 Biến nạp vectơ tái tổ hợp mang đoạn DNA đặc hiệu mà hoá cho homoserin acetyltransferaza vào E.coli DH5 55 3.2.2.3 T¸ch chiết DNA plasmit từ E.coli DH5α 57 3.2.2.4 Kiểm tra có mặt gen metA dòng plasmit tái tổ hợp .58 3.2.3 Xác định trình tự đoạn DNA đặc hiệu gen metA từ chủng C glutamicum 309 ph©n lËp ë ViƯt Nam…………………… … 60 3.2.3.1 Xác định trình tự nucleotit gen metA từ chủng C glutamicum 30960 3.2.3.2 So sánh trình tự nucleotit đoạn DNA đặc hiệu gen met A từ chủng phân lập Việt nam với trình tự giới đà công bố.61 3.2.3.3 Kết dịch mà đoạn DNA gen metA 64 3.2.3.4 So sánh trình tự axit amin đoạn protein dịch mà từ đoạn DNA đặc hiệu gen metA với trình tự giới đà công bố.66 Chương kết luận.68 Tài liệu tham khảo69 Lời cảm ơn Tôi xin bày tỏ lòng biết ơn sâu sắc đến PGS.TS Nguyễn Thuỳ Châu, Trưởng phòng Vi sinh vật, Viện Cơ điện Nông nghiệp Công nghệ Sau thu hoạch đà tận tình hướng dẫn dìu dắt suốt trình hoàn thành luận văn Tôi xin bày tỏ lòng biết ơn chân thành sâu sắc đến PGS.TS Đinh Duy Kháng, Trưởng phòng Vi sinh vật phân tử, Viện Công nghệ sinh học đà tận tình giúp đỡ suốt trình học tập nghiên cứu Tôi xin chân thành cảm ơn Ban LÃnh đạo Viện Cơ điện Nông nghiệp Công nghệ Sau thu hoạch đà tạo điều kiện cho trình công tác nghiên cứu Tôi xin chân thành cảm ơn thầy cô giáo cán Viện Công nghệ sinh học Công nghệ thực phẩm - Trường Đại học Bách khoa Hà Nội đà giảng dạy truyền đạt kiến thức quý báu thời gian học tập trường Tôi xin chân thành cảm ơn cán nghiên cứu phòng Vi sinh vật phân tử - Viện Công nghệ sinh học tập thể Bộ môn Vi sinh - Viện Cơ điện Nông nghiệp Công nghệ Sau thu hoạch đà giúp đỡ tạo điều kiện thuận lợi cho suốt trình học tập nghiên cứu Cuối xin gửi đến gia đình bạn bè tôi, người đà giúp đỡ, động viên suốt trình học tập làm luận văn tốt nghiệp lời biến ơn sâu nặng Hà Nội, tháng 09 năm 2006 Nguyễn Thị Hồng Hà Danh mục chữ viết tắt Bp Base pair (cặp bazơ) dNTP Deoxy Nucleotid Tri Phosphat ddNTP Dideoxy Nucleotid Tri Phosphat EDTA Ethylen Diamine Tetra Acetic Acid EtBr Ethidium Bromide IPTG Isopropyl -β- D-Thiogalactoeyranoside kDa Kilo Dalton LB M«i tr­êng Lauria Betani ORF Open reading frame (khung đọc mở) PCR Polymerase Chain Reaction (phản ứng chuỗi trùng hợp) SDS Sodium Dodecyl Sulfate SAM S-adenosyl-methionine TAE Tris - Acetate - EDTA TE Tris - EDTA Tm Temperature melting (nhiệt độ nóng chảy) X- gal 5-bromo -4-chloro-3-indolyl--D-galactopyranoside Danh mục bảng Bảng 1.1 ảnh hưởng enzym đến ức chế sinh tổng hợp methionin Bảng 1.2 Thành phần plasmid pCRđ 2.1 Bảng 2.1 So sánh lượng - ketobutyrat tính toán phương pháp quang phổ mẫu thí nghiệm so với lượng - ketobutyrat đà cho vào Bảng 2.2 Thành phần phản ứng PCR Bảng 2.3 Chương trình chạy PCR Bảng 2.4 Thành phần phản ứng gắn sản phẩm PCR vào vectơ pCR 2.1 Bảng 2.5 Thành phần phản ứng cắt DNA EcoRI Bảng 3.1 Kết phân lập c¸c chđng vi khn có khả sinh tổng hợp Lmethionin từ mẫu đất số tỉnh Việt Nam Bảng 3.2 Khả sinh L-methionin chủng phân lập Bng 3.3 Kt qu quan sát hình th¸i khuẩn lạc, kÝch thước tế bào bào tử chủng vi khuẩn ph©n lập cã khả sinh tổng hợp L-methionin cao Bảng 3.4 Đặc điểm sinh lý, sinh hoá ca chng vi khuẩn phân lp cã khả sinh tổng hợp L-methionin cao B¶ng 3.5 Kết định lượng xác định độ tinh cđa DNA hƯ gen b»ng quang phỉ kÕ Danh mơc hình đồ thị Sơ đồ 1.1 ức chế ngược enzym hoạt động Sơ đồ 1.2 Mô hình chế điều hoà hoạt tính enzym sinh tổng hợp axit amin Sơ đồ 1.3 Điều chỉnh trình sinh tổng hợp axit amin họ aspartat chủng E coli Sơ đồ 1.4 Điều chỉnh trình sinh tổng hợp axit amin họ aspartat chủng C glutamicum Sơ đồ 1.5 Con đường sinh tổng hợp methionin vi sinh vật khác Sơ đồ1.6 Các enzym điều khiển trình sinh tổng hợp methionin C glutamicum Sơ đồ 1.7 Sơ đồ cấu trúc vị trí cắt vectơ pCR 2.1 Hình 3.1 Sơ đồ miêu tả trình nối ghép tạo vectơ petmetA Hình 3.2 Kết điện di DNA hệ gen gel agaroza 1% Hình 3.3 Kiểm tra sản phẩm PCR chủng C glutamicum 309 gel agaroza 1% Hình 3.4 Chủng E.coli DH5α sau biến nạp nu«i cấy môi trường LB+ampixillin+IPTG+Xgal Hình 3.5 Điện di gel agaroza 1% để chọn plasmit tái tổ hợp mang gen met A Hình 3.6 §iƯn di DNA plasmit t¸i tổ hợp mang sản phẩm PCR đặc hiệu gen metA cắt bng EcoRI Hình 3.7 Điện di đồ plasmit tái tổ hợp mang sản phẩm PCR đặc hiệu gen metA cắt EcoRI Hình 3.8 Trình tự đoạn DNA đặc hiệu gen metA tách dòng từ chủng C glutamicum 309 phân lập Hình 3.9 So sánh độ tương đồng trình tự nucleotit gen metA tách dòng từ chủng C glutamicum 309 phân lËp ë ViƯt Nam (AJ584663) víi tr×nh tù gen metA chủng C glutamicum Soo Dong Park cs công bố Ngân hàng Gen quốc tế Hình 3.10 Trình tự axit amin dịch mà từ đoạn DNA đặc hiệu gen metA tách dòng từ chủng C glutamicum 309 Hình 3.11 So sánh độ tương đồng trình tự axit amin đoạn protein dịch mà từ gen metA tách dòng từ chủng C glutamicum 309 phân lập Việt Nam với trình tự axit amin gen metA đà Soo Dong Park cs công bố Ngân hàng Gen quốc tế 64 3.2.3.3 Kết dịch mà đoạn DNA gen metA Chúng đà tiến hành dịch mà gen metA tách dòng từ chủng C.glutamicum 309 sang protein nhờ chương trình phần mềm PC/Gene Kết thể hình 3.9 170 180 190 200 210 220 | | | | | | ATGCCCACCCTCGCGCCTTCAGGTCAACTTGAAATCCAAGCGATCGGTGATGTCTCCACC METProThrLeuAlaProSerGlyGlnLeuGluIleGlnAlaIleGlyAspValSerThr 230 240 250 260 270 280 | | | | | | GAAGCCGGAGCAATCATTAAAAACGCTGAAATCGCCTATCACCGCTGGGGTGAATACCGC GluAlaGlyAlaIleIleLysAsnAlaGluIleAlaTyrHisArgTrpGlyGluTyrArg 290 300 310 320 330 340 | | | | | | GTAGATAAAGAAGGACGCAGCAATGTCGTCCTCATCGAACACGCCCTCACTGGAGATTCC ValAspLysGluGlyArgSerAsnValValLeuIleGluHisAlaLeuThrGlyAspSer 350 360 370 380 390 400 | | | | | | AACGCAGCCGATTGGTGGGCTGACTTGCTCGGTCCCGGCAAAGCCATCAACACTGATATT AsnAlaAlaAspTrpTrpAlaAspLeuLeuGlyProGlyLysAlaIleAsnThrAspIle 410 420 430 440 450 460 | | | | | | TACTGCGTGATCTGTACCAACGTCATCGGTGGTTGCAACGGTTCCACCGGACCTGGCTCC TyrCysValIleCysThrAsnValIleGlyGlyCysAsnGlySerThrGlyProGlySer 470 480 490 500 510 520 | | | | | | ATGCATCCAGATGGAAATTTCTGGGGTAATCGCTTCCCCGCCACGTCCATTCGTGATCAG MethisProAspGlyAsnPheTrpGlyAsnArgPheProAlaThrSerIleArgAspGln 530 540 550 560 570 580 | | | | | | GTAAACGCCGAAAAACAATTCCTCGACGCACTCGGCATCACCACGGTCGCCGCAGTACTT ValAsnAlaGluLysGlnPheLeuAspAlaLeuGlyIleThrThrValAlaAlaValLeu 590 600 610 620 630 640 65 | | | | | | GGTGGTTCCATGGGTGGTGCCCGCACCCTAGAGTGGGCCGCAATGTACCCAGAAATTGTT GlyGlySerMETGlyGlyAlaArgThrLeuGluTrpAlaAlaMETTyrProGluIleVal 650 660 670 680 690 700 | | | | | | GGCGCAGCTGCTGTTCTTGCAGTTTCTGCACGCGCCAGCGCCTGGCAAATCGGCATTCAA GlyAlaAlaAlaValLeuAlaValSerAlaArgAlaSerAlaTrpGlnIleGlyIleGln 710 720 730 740 750 760 | | | | | | TCCGCCCAAATTAAGGCGATTGAAAACGACCACCACTGGCACGAAGGCAACTACTACGAA SerAlaGlnIleLysAlaIleGluAsnAspHisHisTrpHisGluGlyAsnTyrTyrGlu 770 780 790 800 810 820 | | | | | | TCCGGCTGCAACCCAGCCACCGGACTCGGCGCCGCCCGACGCATCGCCCACCTCACCTAC SerGlyCysAsnProAlaThrGlyLeuGlyAlaAlaArgArgIleAlaHisLeuThrTyr 830 840 850 860 870 880 | | | | | | CGTGGCGAACTAGAAATCGACGAACGCTTCGGCACCAAAGCCCAAAAGAACGAAAACCCA ArgGlyGluLeuGluIleAspGluArgPheGlyThrLysAlaGlnLysAsnGluAsnPro 890 900 910 920 930 940 | | | | | | CTCGGTCCCTACCGCAAGCCCGACCAGCGCTTCGCCGTGGAATCCTACTTGGACTACCAA LeuGlyProTyrArgLysProAspGlnArgPheAlaValGluSerTyrLeuAspTyrGln 950 960 970 980 990 1000 | | | | | | GCAGACAAGCTAGTACAGCGTTTCGACGCCGGCTCCTACGTTTTGCTCACCGACGCCCTC AlaAspLysLeuValGlnArgPheAspAlaGlySerTyrValLeuLeuThrAspAlaLeu 1010 1020 1030 1040 1050 1060 | | | | | | AACCGCCACGACATTGGTCGCGACCGCGGAGGCCTCAACAAGGCACTCGAATCCATCAAA AsnArgHisAspIleGlyArgAspArgGlyGlyLeuAsnLysAlaLeuGluSerIleLys 1070 1080 1090 1100 1110 1120 | | | | | | GTTCCAGTCCTTGTCGCAGGCGTAGACACCGATATTTTGTACCCCTACCACCAGCAAGAA ValProValLeuValAlaGlyValAspThrAspIleLeuTyrProTyrHisGlnGlnGlu 66 1130 1140 1150 1160 1170 1180 | | | | | | CACCTCTCCCGAAACCTGGGAAATCTACTGGCAATGGCAAAAATCGTATCCCCTGTCGGC HisLeuSerArgAsnLeuGlyAsnLeuLeuAlaMETAlaLysIleValSerProValGly 1190 1200 1210 1220 1230 1240 | | | | | | CACGATGCTTTCCTCACCGAAAGCCGCCAAATGGATCGCATCGTGAGGAACTTCTTCAGC HisAspAlaPheLeuThrGluSerArgGlnMETAspArgIleValArgAsnPhePheSer 1250 1260 1270 1280 1290 | | | | | CTCATCTCCCCAGACGAAAACAACCCTTCGACGTACATCGAGTTCTACATC LeuIleSerProAspGluAsnAsnProSerThrTyrIleGluPheTyrIle H×nh 3.10: Tr×nh tù axit amin dịch mà từ đoạn DNA đặc hiệu gen metA tách dòng từ chủng C glutamicum 309 Kết hình 3.10 cho thấy: gen metA tách dòng từ chủng C glutamicum 309 phân lập Việt Nam dịch mà nucleotit thứ 164 mà hoá cho đoạn protein có chiều dài 377 axit amin ATG vµ ATC lµ bé ba khëi đầu ba kết thúc trình dịch mà 3.2.3.4 So sánh trình tự axit amin đoạn protein dịch mà từ đoạn DNA đặc hiệu gen metA với trình tự giới đà công bố Chúng đà tiến hành so sánh trình tự axit amin đoạn protein dịch mà từ gen metA tách dòng từ chủng C glutamicum 309 phân lập ë ViƯt Nam víi tr×nh tù axit amin cđa cïng gen đà Soo Dong Park cộng công bố Ngân hàng gen Quốc tế Kết hình 3.11 PMETA_VN - MPTLAPSGQLEIQAIGDVSTEAGAIIKNAEIAYHRWGEYRVDKEGRSNVV -50 |||||||||||||||||||||||||| ||||||||||||||||||||||| PMETA_KR - MPTLAPSGQLEIQAIGDVSTEAGAIITNAEIAYHRWGEYRVDKEGRSNVV -50 PMETA_VN - LIEHALTGDSNAADWWADLLGPGKAINTDIYCVICTNVIGGCNGSTGPGS -100 |||||||||||||||||||||||||||||||||||||||||||||||||| PMETA_KR - LIEHALTGDSNAADWWADLLGPGKAINTDIYCVICTNVIGGCNGSTGPGS -100 PMETA_VN - MHPDGNFWGNRFPATSIRDQVNAEKQFLDALGITTVAAV LGGSMGGAR -148 67 ||||||||||||||||||||||||||||||||||||||| ||||||||| PMETA_KR - MHPDGNFWGNRFPATSIRDQVNAEKQFLDALGITTVAAVVLLGGSMGGAR -150 PMETA_VN - TLEWAAMYPEIVGAAAVLAVSARASAWQIGIQSAQIKAIENDHHWHEGNY -198 |||||||||| ||||||||||||||||||||||||||||||||||||||| PMETA_KR - TLEWAAMYPETVGAAAVLAVSARASAWQIGIQSAQIKAIENDHHWHEGNY -200 PMETA_VN - YESGCNPATGLGAARRIAHLTYRGELEIDERFGTKAQKNENPLGPYRKPD -248 |||||||||||||||||||||||||||||||||||||||||||||||||| PMETA_KR - YESGCNPATGLGAARRIAHLTYRGELEIDERFGTKAQKNENPLGPYRKPD -250 PMETA_VN - QRFAVESYLDYQADKLVQRFDAGSYVLLTDALNRHDIGRDRGGLNKALES -298 |||||||||||||||||||||||||||||||||||||||||||||||||| PMETA_KR - QRFAVESYLDYQADKLVQRFDAGSYVLLTDALNRHDIGRDRGGLNKALES -300 PMETA_VN - IKVPVLVAGVDTDILYPYHQQEHLSRNLGNLLAMAKIVSPVGHDAFLTES -348 |||||||||||||||||||||||||||||||||||||||||||||||||| PMETA_KR - IKVPVLVAGVDTDILYPYHQQEHLSRNLGNLLAMAKIVSPVGHDAFLTES -350 PMETA_VN - RQMDRIVRNFFSLISPDENNPSTYIEFYI -377 |||||||||||||||||| |||||||||| PMETA_KR - RQMDRIVRNFFSLISPDEDNPSTYIEFYI -379 Hình 3.11 So sánh độ tương đồng trình tự axit amin đoạn protein dịch mà từ gen metA tách dòng từ chủng C glutamicum 309 phân lập Việt Nam với trình tự axit amin gen metA đà Soo Dong Park cs công bố Ngân hàng Gen quốc tế Kết hình 3.11 cho thấy trình tự axit amin đoạn protein dịch mà từ gen metA tách dòng từ chủng C glutamicum 309 phân lập Việt Nam trình tự axit amin dịch mà từ gen metA đà Soo Dong Park cộng công bố Ngân hàng Gen quốc tế có độ tương đồng cao, đạt tới 99,20% Sự sai khác xảy hai axit amin VL vị trí 137-139 68 Chương kết luận Từ 450 mẫu đất lấy tỉnh miềm Bắc Việt nam, đà tiến hành phân lập 26 chủng vi sinh vật có khả sinh tổng hợp methionin, có chủng có khả sinh tổng hợp methionin cao Dựa vào khoá phân loại Bergey, kết luận chủng vi khuẩn C glutamicum Đà tuyển chọn chủng C glutamicum 309 (C.g 309) có khả sản sinh L-methionin cao nhất, đạt 5,0 g/l Đà nhân thành công đoạn gen metA cặp mồi hser p15 hser M9 số chủng C glutamicum phân lập Đà tạo dòng đoạn DNA mang gen metA m· ho¸ cho homoserin acetyltransferaza tõ C glutamicum 309 cách gắn vào vectơ tách dòng pCR 2.1 biến nạp vào E coli DH5 Đà xác định đoạn DNA mang gen metA mà hoá cho homoserin acetyltransfeaza từ C glutamicum 309 Đoạn có chiều dài 1486 nucleotit, mà hóa cho đoạn protein gåm 348 axit amin Tr×nh tù nucleotit cđa gen metA cđa chđng C glutamicum 309 vµ cđa chđng C glutamicum đà Soo Dong Park cs công bố Ngân hàng Gen quốc tế có độ tương đồng cao, đạt 99,06% Trình t gen met A tách dòng t C glutamicum phân lập Việt nam đà đăng ký Ng©n hàng Dữ liệu gen Quốc tế với số đăng ký AJ584663 Tr×nh tù axit amin cđa đoạn protein dịch mà từ gen metA tách dòng từ C glutamicum 309 trình tự axit amin dịch mà từ gen metA đà Soo Dong Park cs công bố Ngân hàng Gen Quốc tế có độ tương đồng cao, đạt 99,20% Hướng nghiên cứu tiếp BiĨu hiƯn gen met A m· ho¸ cho homoserin acetyltransferaza C glutamicum Xác định hoạt tính homoserin acetyltransferaza tái tổ hợp Nghiên cứu qui trình công nghệ sản xuất methionin chủng tái tổ hợp qui mô công nghiệp 69 Tài liệu tham khảo Tiếng Việt Kiều Hữu ảnh, (1998), Cơ sở hoá sinh vi sinh vật học Công nghiệp, nhà xuất KHKT-Hà nội Nguyễn Thị Lộc, (2004), Nghiên cứu hoàn thiện qui trình ủ chua sắn sử dụng methionin phần thức ăn nuôi lợn thịt, Luận án tiến sĩ Nông nghiệp Lê Đình Lương, (2001), Nguyên lý kỹ thuật Di truyền, nhà xuất KHKT-Hà nội Bùi Thị Oanh, (1996), Nghiên cứu ảnh hưởng mức lượng, tỷ lệ protein, lysin, methionin cystin thức ăn hỗn hợp đến suất gà sinh sản hướng thịt gà Broiler nuôi theo mùa vụ, Luận án phó tiến sĩ Nông nghiệp Trần Tích, (2000), Thực hành hoá sinh học, Đại học sư phạm - Hà nội Khuất hữu Thanh, (2005), Bài giảng dành cho học viªn cao häc 20052007– Kü thuËt gen Vi sinh vËt”, Đại học Bách khoa-Hà nội Nguyễn Quang Thạch, (2005), Công nghệ sinh học Nông nghiệp, nhà xuất Nông nghiÖp TiÕng Anh Andersen G.L., Beattie G.A., Lindow S.E (1998), “Molecular characterization and sequence of a methionine biosynthetic locus from Pseudomonas syringae”, J Bacteriol, pp 507 - 4497 Adeniran S.A., Odunfa S A (2000), “ Evaluation of lysins and methionine prodution in some Lactobacilli and yeasts from Ogi”, International journal of food microbiology, 63, pp 159-163 70 10 Adeniran Stein., Philippe Riegel (2004), “Corynebacterium species isolated from bone and joint infections identified by 16S rRNA gene sequence analysis”, Journal of clinical microbiology, pp 2231-2233 11 Atsushi Hayakawa., Masakaza, Sugimoto., Yasuhiko Yoshihaza., Tsuyoshi Nakamatsu (2001), “US6,221636B1”, United State Patent Application Publication 12 Agui L., Manso J (2004), “Colloidal-gold cysteamine-modified carbon paste electrodes as suitable electrode materials for the electrochemical determination of sulphur – containing compounds application to the determination of methionine”, Talanta, 64, pp 1041-1047 13 Ausubel F., Brent R., Kingston R E., et al (1995), “ Short protocols in molecular biology”, Compendium of methods from current protocols in molecular biology, 3rd endition, Wiley, USA 14 Bachmann F., Sonnen H., Kutzner H.J (1992), “Plasmid curing in Corynebacteria with penicillin”, G DECHAMA Biotech Conf, pp 853 - 856 15 Baker DH (1989), “Amino acid nutrition in pigs and poultry”, In: Haresign W, Cole DJA, editors, Recent advances in animal nutrition, London: Butterworths, pp: 59-249 16 Bathe., Brigitte., Moeckel (2005), “Isolated polynucleotide from Corynebacterium homocysteine methyltrasferase”, United states patent 6942996 17 Baroni M., Livian S., Martegani E., Alberghina L (1986), “Molecular cloning and regulation of the expression of the met2 gene of Saccharomyces cerevisiae”, Gene, 46 (1), pp 71-8 18 Banik AK., Majumdar SK (1974), “ Studies on methionone fermentation: Part I Selection of mutants of Micrococcus glutamicus and optimum conditions for methionine production”, Indian J Exp Biol, 12, pp: 5-363 71 19 Banik AK., Majumdar SK (1975), “ Effect of minerals on production of methionine by Micrococcus glutamicus”, Indian J Exp Biol, 13, pp: 2-510 20 Biasaria V.S., Kumar D., Garg S (2003), “Production of methionine by a multi-analogue resistant mutant of Corynebacterium lilium” Process biochemistry, 38, pp 1165-1171 21 Bergey (1986), “Manual of synthematic bacterialogy”, Williams and Wilkins Co 22 Carmen Palaez., Felix Amarita., Teresa Requena (2001), “Conversion of methionine to methional by Lactococcus lactis” FEMS Microbiology letters, 204, pp 189-195 23 Cen.P.L., Liu H., Lin.J.P., Pan y.J (2004), “Co-production of S-adenosylL-methionine and glutathione from spent brewer’ s yeast cell” Process biochemistry, 39, pp 1993-1997 24 Cox S.J., Shalel levanon S., Sanchez A (2006), “Development of a metabolic network design and opimization framework incorporating implementation constraints: a succinate production case study”, Metab Eng, (1), pp 46-57 25 Cowan and Steel’s (1974), “ Manual for the identification of medical bacteria”, Cambridge University Press, London 26 Dharmendra Kumar., Kartik Subramanian (2005), “Effect of cysteine on methionine production by a regulatory mutant of Corynebacterium lilium” Bioresource technology, 96, pp 287-294 27 Dulaney E.L (1967), “Microbial production of aminoacids” In Microbial Technology Reinhold Publ Co; New York 28 Durando X., Cellarier E (2003), “Methionine dependency and cancer treatment”,Cancer treatment reviews, pp.489-499 72 29 Egorov N., X (1983) , “Thùc tËp vi sinh vËt häc”, NXB Mir Moxkova vµ KHKT Hà nội (Nguyễn Lân Dũng dịch) 30 Felix Amarita., Mireille Yvon (2004),“ Identification and Functional Analysis of the gene Encoding Methionine-γ-Lyase in Brevibacterium linns” Applied and environmental microbiology, 70 (12), pp 7348-7354 31 Filpula D., Ally A.H., Nagle J (1986), “Complete nucleotide sequence of a native plasmid of Brevibacterium lactofermentum”, Nucleic Acids Res, 14, pp 5114 32 James G., Cappuccino., Natalie Sherman (1996), “Microbiology a laboratory manual”, pp 311- 313 33 James Gomes., Dharmendra Kumar (2004), “Production of L-methionine by fermentation” Department of Biochemical Engineering and Biotechnology, Indian Institute of technolog, New delhi 110016, India, pp 4161 34 James Gomes., Dharmendra Kumar (2005), “Production of L-methionine by submerged fermentation”, Department of Biochemical Engineering and Biotechnology, Indian Institute of technology, New delhi 110016, India, pp 318 35 Jens Olaf Kromer., Christoph Wittmann., Hartwig Schroder., Elmar Heinzle (2006), “ Metabolic pathway analysis for rational design of Lmethionine production by Escherichia coli and Corynebacterium glutamicum”, Biochemical Engineering, Saarbrucken Universit, Saarbrucke, Germany 36 Jian Ping Lin., Jun Tian., Jian Feng You (2004), “An effective strategy for the co-prodution of S-adenosyl-L-methionine and glutathione by fed-batch fermentation”, Biochemical engineering journal, 21, pp 19-25 73 37 Jianlin Si J.H., Kersey C.A (2004), “An evaluation of the interaction of Lysine and Methionine in Diets for growing Broilers”, International journal of Poultry Science, pp 51-60 38 J David Rozzell., Jr., Burbank (1999), “ Methods and compositions for quantitating L- homocysteine and L-methionine in a solution”, BioCatalytics, Inc, Burbank calif, United states patent number: 5,885,767, pp 1-24 39 Katsumata R., Ozaki A., Kon T., Furuya A (1984), “Protoplast transformation of glutamate producing bacteria with ADN”, J Bacteriol, 159, pp 306 - 311 40 Kati Erdmann., Nina Grosser., Henning Schroder (2005), “L-Methionine reduces oxidant stress in Endothelial cell: Role of Heme oxygenase-1, ferritin and Nitric oxide”, Department of pharmacology and toxicology, School of pharmac, Martin luther universit, 06099 halle, Germany, pp.195-200 41 Kageyama S., Morinaga T., Kawada N (1986), “Production of methionine Agency of Industrial Sciences and Technology”, Japan Kokai Tokkyo Koho JP 61268189 42 Kase H., Nakayama K (1974), “ Production of O-acetyl-L-homoserine by methionine analog resistant mutants and regulation of homoserine –Otransacetylase in Corynebacterium glutamicum”, Agric Biol Chem, 38, pp: 302021 43 Kase H., Nakayama K (1979), “L- Methionine production by analog resistant mutant derived from threonin producing strain of C glutamicum”, Agric.Biol Chem, 41, pp 109-116 44 Kumar D., Bisaria VS., Sreekrishan Tr., Gomes J (2003), “ Production of methionine by a multi-analogues resistant mutant of Corynebacterium lilium”, Process Biochem, 38, pp: 71-1165 74 45 Kurtis D., Korver., Leonard P (2002), “Round window application of Dmethionine provides complete cisplatin otoprotection”, Otolaryngology head and Neck surger, pp 683-689 46 Kumar D., Subramanian K (2005), “Effect of cysteine on methionine production by a regulatory of Corynebacterium lilium”, Bioresour Technol, 96 (3), pp 287-294 47 Lee Y.H (1994), “Abalone sperm lysin: molecular evolution of fertilization protein, implications concerning the species-specificity of fertilization and speciation in marine inverte-brates”, Ph.D Dissertation University of California, San Di-ego 48 Lee H.S., Hwang B.J (2003), “Methionine biosynthesis and its regulation in Corynebacterium: parallel pathways of transsulfuration and direct sulfhydrylation”, Appl Microbiol Biotechnol, pp 459-467 49 Lewis C.A., Talbo C F., Vacquier V D (1982), “A protein from abalone sperm dissolves the egg vitelline layerby a non-enzymatic mechanism”, Dev, Biol, 92, pp 227 - 239 50 Hwang B.-J., Yeom H.-J., Younhee K (2002), “Corynebacterium glutamicum utilizes both transsulfuration and direct sulfhydrylation for Methionine biosynthesis”, Journal of bactericlogy, American Society for microbiology, 184, pp 1277-1286 51 Invitrogen life technologies (2002), “ TOPO – TA cloning kit” 52 Martin J.F (1989), “Molecular genetics of amino acid producing Corynebacteria Symp”, Soc, Gen Microbiol, Vol 44, pp 25 - 59 53 Michael V., Martinov Victor M., Vitvitsky et al (2000), “A Substrate switch: A new mode of regulation in the methionine metabolic pathway”, J.theor Biol NE 68588-0664 USA, pp 521-532 54 Michael C., Reed H., et al (2004), “A mathematical model of the methionine cycle”, Journal of theoretical biology, 226, pp 33-43 75 55 Morinaga Y., Tsuchiya M., Miwa K., Sano K (1987), “Expression of Escherichia coli promoters in Brevibacterium lactofermentum using the shuttle vector pEB003”, J Biotechnol,Vol 5, pp 305 - 312 56 Mondal S., Das YB., Chatterjee SP (1996), “ Methionine production by microorganisma”, Folia microbiol, 41, pp: 72-465 57 Mukherjee K.J., Deb J.K., Ramachandran K.B (1990), “Construction of vector of Brevibacterium lactofermentum and study of its stability in continuous culture”, J Biotechnol, Vol 16, pp 109 - 122 58 Muse S.V (1996), “Estimating synonymous and nonsynony-mous substitution rates”, Mol Biol Evol, Vol13, pp 105 - 114 59 Nevera J., Hochmannovor J., Portek M (1998), “An integron of class is present on the plasmid pCG4 from Gram-positive bacterium Corynebacterium glutamicum”, FEMS Microbiol Lett, Vol 169, pp 391 - 395 60 Odunfa S.A., Teniola O.D (2000), “The effects of processing methods on the levels of lysine, methionine and the general acceptability of ogi processed using starter cultures”, International journal of food microbiology, 63 (2001), pp -9 61 Ojano Dirain et al (2002), “Evaluation of lysine, methionine and threonine needs of Broilers three to six week of age moderate temperature stress”, I International journalof poultry science 1, pp 16-21 62 Papirov chromotografic aminokyselin, Lumyt Macholan, ladislar skurskys, pet zboril Cvicini biochemic, Univerzita J.E Purkyne Brono, faculta prirodovideck(1975) 63 Pompejus markus., Kroger et al (2004), “Corynebacterium glutamicum genes en homeostasis and adaptation”, United states patent 6831165 64 Pascal Bonnarme and Lefki Psoni (2000), “Diversity of L-methionine catabolism pathways in cheese - Ripening bacteria”, Applied and environmental microbiology, Vol 66 (12), pp 5514-5517 76 65 Ponder W F., Lindeerg D R (1997), “Towards a phylogeny of gastropod molluscs: an analysis using morphologicalcharacters”, Zool J Linn Soc,Vol 119, pp 83 - 265 66 Pham CB., Galvez CF., Padolina WG (1992), “ Methionine fermentation by batch fermentation from various carbohydrates”, ASEAN Food J, 7, pp: 734 67 Gang S (2002), “Development of a nonlinear controller for the production of L-methionine by a mutant strain of Corynebacterium lilium”, Tech Thesis IIT Delhi India 68 Ghosh BB., Banerjee AK (1986), “ Production of methionine and glutamic acid from n-alkanes by Serratia marcescens var kiliensis”, Folia Microbiol, 31, pp: 12-106 69 Sabu Kasai and Tomokazu Yamazaki (2001), “ Identificayion of the cobalamin-dependent metionine synthase gene, metH, in Vibrio fischeri ATCC 7744 by sequencing using genomic ADN as a template”, An internation jounal on gene and genomes Gene, 264, pp 281-288 70 Sahm H.L., Eggeling B., Eikmanns and Krämer R (1995), “MetA bolic design in amino acid-producing bacterium Corynebacterium glutamicum”, FEMS Microbiol Rev,Vol 16, pp 243 - 252 71 Sambrook J., Fistch F., Maniatis T (1989), “Moleculer cloning I, II, III” A loboratory mannual Cold Spring Harbo Laboratory Press 72 Sambrook J., Russell D W (2001), “ Molecullar cloning”, A laboratory manual, 3rd ed, Cold spring Harbor laboratory press, Cold spring harbor, NY 73 Santamaria R., Gil J.A., Martin J.F (1985), “High frequency transformation of Brevibacterium lactofermentum protoplasts by plasmid ADN”, J Bacteriol, Vol 162, pp 463 - 467 77 74 Santamaria R., Gil J.A., Mesas J.M., and Martin J.F (1984), “Characterization of an endogenous plasmid and developmentof cloning vectors and a transformation system in Brevibacterium lactofermentum”, J Gen Microbiol, Vol 130, pp 2237 - 2246 75 Sanger F., Nicklen S., Coulson A., R (1977), “ DNA sequencing with chain termination inhibitors”, Proceeding of the national academy of sciences of the USA, 74, pp: 5463-5467 76 Schojfer A.J., Kalinowski R., Simon A.H (1990), “High-frequency conjugal plasmid transfer from gram-negative Escherichia coli to various gram-positive Coryneform bacteria”, J Bacteriol, Vol172, pp 1663 - 1666 77 Sharma S., Gomes J (2001), “Effect og dissolve oxygen on continuous production of methionine”, Chem Eng Technol, 1, pp 69-73 78 Shinohara Y., Hasegawa H., Tagoku K., et al (2001), “ Simultaneous determination of methionine and total homocysteine in human plasma by gas chromatography-mass spectrometry”, J Chromatogr B: Biomed Sci Appl 2001, 758(2), pp 8-549 79 Soo Dong Park and Younhee Kim (1998), “Isolation and Analyis of MetA, a methionin biosynthetic Gene Encoding Homoerine Acetyltransferase in Corynebacterium glutamicum”, Mol Cells., Vol 8, pp 284 - 294 80 Tripathi C.K.M., Tyagi and Vinod Bihari (2000), “Microbial prodution of D-amino acids”, Process biochemistry, 35, pp 1247-1251 81 Trotschel., Christian and Kramer (2005), “Method for fermentation of Lamino acids by use of recombinant coryne from bacteria”, International publication number WO 2005/085463 82 Townsend DM., Tew KD., Tapiero H (2004), “ Sulfur containing amino acids and human disease”, Biomed Pharmacother 58(1), pp 47-55 83 Vogel and Shimura (1966), “Spectophotometric determination of lysin”, Bacreriology journal, Vol 118 78 84 Wada M., Awano N., Takagi H (2002), “ Purification, characterization and identificayion of cysteine desulfhydrase of Corynebacterium glutamicum, and its relationship to cysteine production”, FEMS Microbiol Lett 217, pp 103-207 85 Yoshihirp Usuda and Osamu kurahashi (2005), “ Effects of deregulation of methionine biosynthesis on methionine excretion in E.coli”, Applied and environmental microbiology, Japan, pp 3228-3234 86 Zupanic T.J., Kittle J.D., Baker B.D., Miller C.J., Palmer D.T., Asai Y., Inui M., Vertes A., Kobayashi M., Kursu Y., and Yukawa H (1995), “Isolation of promoters from Brevibacterium Flavum strain MJ 233C and comparison of their gene expression levels in B Flavum and E coli”, FEMS Microbiol, Lett, Vol 131, pp 121 - 126 87 http://au.expasy.org>*: phần mền chuyên dụng để xử lý trình tự DNA theo địa Internet ... xuất L- methionin Việt nam, đà nghiên cứu đề tài Phân l? ??p, tuyển chọn chủng Corynebacterium glutamicum tách dòng gen met A mà hoá enzym Homoserine Acetyltransferase sinh tỉng hỵp axit amin L- methionin? ??... acetyl transferaza Methionin + S (C glutamicum vµ B flavum) adenosylmethionin metA Methionin Cystathionin-γ-synthaza - metB Methionin β-cystathioninsaza - metC Methionin Cystathionin –β-lyaza... 4-phospho aspartat aspartat kinaza sau bị oxy hoá aspartaldehit dehydrogenaza tạo thành aspartat semi-aldehit Từ aspartat semialdehit rẽ đường, tạo dihydropicolinat dihydropicolinatesynthaza, dẫn