the general layout of a steel plant should represent the overall project concept of the dynamic operation of the manufacturing process
metallurgical process engineering
... permeability of the steel manufacturing process 80 Relationship analysis among basic parameters and derivative 102 parameters in the system of steel manufacturing process 104 Evolution of steel manufacturing ... manufacturing process Schematic of concept of analysis-integration of steel manufacturing process 106 The block diagram of analysis-integration model of steel manufacturing process 107 Schematic of ... Material and energy input and output of the blast furnace Material and energy input and output of BOF steelmaking The temperature- time track of mass flow in BF-BOF process Diagram of material,...
- 361
- 675
- 0
Báo cáo khoa học: "Combining Tree Structures, Flat Features and Patterns for Biomedical Relation Extraction" ppt
... unlexicalized parsing In Proceedings of ACL 2003, pages 423–430, Sapporo, Japan David McClosky 2010 Any Domain Parsing: Automatic Domain Adaptation for Natural Language Parsing Ph.D thesis, Department of ... dependent of X}) Apart from the above types of features, we also add features for lemmas of the immediate preceding and following words of the candidate entities These feature names are augmented ... ratio of negative and positive examples has been used as the value of the costratio-factor parameter We have done parameter tuning following the approach described by Hsu et al (2003) Downloaded...
- 10
- 377
- 0
Báo cáo y học: "he paediatric flat foot and general anthropometry in 140 Australian school children aged 7 - 10 years" ppsx
... angela.evans@unisa.edu.au School of Health Science, Division of Health Science, University of South Australia, City East Campus, North Terrace, Adelaide 5000, South Australia The definition of ... Evans Journal of Foot and Ankle Research 2011, 4:12 http://www.jfootankleres.com/content/4/1/12 RESEARCH JOURNAL OF FOOT AND ANKLE RESEARCH Open Access The paediatric flat foot and general anthropometry ... presence of flat footed posture has long been described as a foot abnormality often associated with pain and poor function For this reason, many parents are naturally anxious to obtain prophylactic advice...
- 8
- 396
- 0
Tài liệu Báo cáo khoa học: Fatty acid synthesis Role of active site histidines and lysine in Cys-His-His-type b-ketoacyl-acyl carrier protein synthases ppt
... substrate appeared to be present in some of the assay lanes than at the start of the assay (Fig 7B, lane 1) results from the continued activity of the malonylCoA–ACP transacylase To summarize, the ... H298Q, CGATTACCTGAACTCCCAGGGTACTTCGAG TCCG K328H, (5¢-GGCGATTTCTGCAACCCACGCCATGAC CGGTCAC-3¢) K328R, (5¢-GGCGATTTCTGCAACCCGTGCCATGAC CGGTCAC-3¢) K328E, (5¢-GGCGATTTCTGCAACCGAAGCCATGA CCGGTCAC-3¢) ... rule out the triacetic acid lactone hypothesis, as triacetic acid lactone cannot breakdown to give acetyl-ACP Either the acetyl carbanion has a significant lifetime in the absence of an acyl acceptor...
- 16
- 450
- 0
Tài liệu Báo cáo khoa học: The undecided serpin The ins and outs of plasminogen activator inhibitor type 2 pdf
... metastatic cancer, apoptosis and infection Cancer A number of in vivo studies have assessed the prognostic relevance of tumour- and stromal-derived PAI-2 in the metastatic spread of cancer of the ... structure and all lack conventional signal sequences and are, for the most part, located intracellularly Closer examination of the genomic structure of PAI-2 revealed another distinctive feature, that ... trophoblasts [29,30] and it was conjectured that PAI-2 acted to protect the placenta from proteolytic degradation towards the end of the gestational period and to regulate postpartum haemostasis...
- 10
- 466
- 0
Tài liệu Báo cáo khoa học: "Extracting Comparative Entities and Predicates from Texts Using Comparative Type Classification" pptx
... relevant features and proper machine learning techniques The final experimental results in 5-fold cross validation show the overall accuracy of 88.59% for the first task and the overall accuracy of ... However, as CKs play the most important role, they are represented as a combination of their lexicalization and POS tag, e.g., “같/pa1.” Finally, the feature has the form of “X y” (“X” means a sequence ... represented as a combination of their lexicalization and POS tag After feature generation, we calculate each probability value of all CE-candidates using SVM For example, if a sentence has three...
- 9
- 405
- 0
Báo cáo khoa học: Insertion of the plant photosystem I subunit G into the thylakoid membrane In vitro and in vivo studies of wild-type and tagged versions of the protein doc
... underlined) or 5¢-TGGAGCCACCCGCAGTTCGAAAAAGAA GCTGGAGATGATCGTGCT-3¢ (Strep-tag underlined), then a secondary amplification with primers 5¢-CACCAC CACCACCACCACGAAGCTGGAGATGATCGTGCT-3¢ (His-tag underlined) ... 5¢-TGGAGCCACCCGCAGTTCG AAAAAGAAGCTGGAGATGATCGTGCT-3¢ (Strep-tag underlined) and 5¢-GCGGCATGCTCATCCAAAGAAGC TTGGGTCG-3¢ The two amplified fragments were used as a combined template for the tertiary amplification, ... 5¢-GCGGAGCTCAT GGCCACAAGCGCATCAGC-3¢ and 5¢-GCGGCATGCT CAGTGGTGGTGGTGGTGGTGTCCAAAGAAGCTTG GGTCGTAT-3¢ (His-tag underlined); PSAG with a C-terminal Strep-tag (PSI-G-StrepTerm), 5¢-GCGGAGCTCAT GGCCACAAGCGCATCAGC-3¢...
- 9
- 422
- 0
Báo cáo Y học: Characteristics of binding of insulin-like growth factor (IGF)-I and IGF-II analogues to the type 1 IGF receptor determined by BIAcore analysis pptx
... from the calculation of kd/ka, where ka is the association rate and kd is the dissociation rate Relative Kd is equal to Kd of IGF-I/Kd of IGF analogue Dashes indicate data inappropriate for assessing ... biological activity of analogues However, comparisons of receptor binding and biological activities, such as protein and DNA synthesis and protein degradation, have been made in the past and they generally ... and Table 1) The association and dissociation rates of these analogues were too rapid to be accurately measured, and therefore their steady-state af®nities were determined There was a 200-fold...
- 8
- 482
- 0
Đề tài " Quasilinear and Hessian equations of Lane-Emden type " docx
... that the usual p-capacity cap1, p used in the studies of the p-Laplacian [HKM], [KM2] plays a secondary role in the theory of equations of Lane-Emden type Relations between these and other capacities ... many fundamental results, and relations to other areas of analysis and geometry are presented The theory of fully nonlinear equations of Monge-Amp`re type which e involve the k-Hessian operator ... order, and analysis of dyadic models, along with the Hessian measure and weak continuity results [TW2]–[TW4] The latter are used to bridge the gap between the dyadic models and partial differential...
- 58
- 375
- 0
Báo cáo khoa học: Isolation, characterization, sequencing and crystal structure of charybdin, a type 1 ribosome-inactivating protein from Charybdis maritima agg. potx
... ImageQuant software was used for quantification comparing the relative darkness 2690 Total plant DNA was extracted from the bulb Approximately 0.1 g of material cut from the inner part of the bulb was ... HypercassetteTM (Amersham, Chalfont St Giles, UK) autoradiography cassettes, the Imaging Plate (Fujifilm, Tokyo, Japan) and the Storm 840 imaging system (Molecular Dynamics, Sunnyvale, CA, USA) ImageQuant ... molecular replacement In the N-terminal domain, a section of five strands of the b-sheet and one flanking a- helix was found to be relatively invariant on the basis of structural alignments using the...
- 9
- 424
- 0
Báo cáo khoa học: Characterization and structural modeling of a new type of thermostable esterase from Thermotoga maritima ppt
... encodes a protein of 412 amino acids and has a calculated molecular mass of 46.5 kDa BLAST-P analysis revealed the highest similarity to other hypothetical proteins and putative hydrolases The most ... GATCTCAATAACTTGATGATTTCAGG-3¢ and 5¢-CTC CTGAAATCATCAAGTTATTGAGATCGTCG-3¢, respectively (the underlining indicates the modified codon) Mutations were confirmed by sequence analysis of both DNA strands ... include a tertiary structure called the a ⁄ b-hydrolase fold and a catalytic triad consisting of a serine, aspartate and histidine residue A comparison of TM0336 with the amino acid sequences of the...
- 11
- 460
- 0
Báo cáo khoa học: "Tractability and Structural Closures in Attribute Logic Type Signatures" pptx
... constraints are generated, and as small changes in a partial order of types can have drastic effects on other parts of the signature because of appropriateness, incremental compilation of the grammar ... completions are a practical step towards providing a semantics for arbitrary partial orders, they are generally viewed as an impractical preliminary step to performing computations over a partial order ... most general type) Figure is not a meet semi-lattice because and not have a meet, nor and , for example In the nite case, the assumption that every pair of types has a meet is equivalent to the assumption...
- 8
- 349
- 0
Báo cáo Y học: Structural and functional characterization of a C-type lectin-like antifreeze protein from rainbow smelt (Osmerus mordax) potx
... be the case This may be relevant to the calculation of smelt AFP activity The activity of smelt AFP is about one-third of that of sea raven AFP on a monomer concentration basis [11] As sea raven ... migrate faster than its actual mass would predict because of limited linearization in SDS The value of 38 kDa is consistent with such a dimer band A small amount of a high-molecular-mass aggregate ... EDTA instead of CaCl2 In the absence of added Ca2+, dimerization was again observed (Fig 5C) The molecular mass of smelt AFP determined by HPLC gel-filtration analysis was 50 kDa (Fig 6) As the...
- 8
- 518
- 0
Báo cáo khoa học: Expression, purification and characterization of the second Kunitz-type protease inhibitor domain of the human WFIKKN protein pot
... the elastase cleavage occurred at the boundary of the b-galactosidase region of the b-gal fusion protein The amino acid sequence of the resulting purified protein was RTDACVLPAVQGPCRGWEPRWAYS PLLQQCHPFVYGGCEGNGNNFHSRESCEDACPVP, ... Bz-Phe-Val-Arg-pNA substrate concentration; human plasma kallikrein at nM enzyme and 650 lM D-Pro-Phe-Arg-pNA substrate concentration, and the inhibition of human tissue plasminogen activator was measured ... with a 8-s time constant and a scan rate of 10 nmÆmin)1 The spectral slit width was 1.0 nm All measurements represent the computer average of three scans Secondary structure of the recombinant...
- 7
- 292
- 0
Báo cáo khoa học: The relationship between thermal stability and pH optimum studied with wild-type and mutant Trichoderma reesei cellobiohydrolase Cel7A ppt
... the sample at 340 nm was plotted as a function of temperature and differentiated by using Origin 6.0 graphics and data analyses software The culmination point of each curve was taken as the melting ... also calculated When the unfolding of the intact enzyme (containing the CBD) was compared to that of the catalytic domain a very similar pH-dependent behaviour was observed, indicating that the ... chains In order to evaluate further the design of the mutations, it was of interest how the stability behaviour of the protein was changed by the mutations, particularly those in neutral and alkaline...
- 8
- 422
- 0
Báo cáo khoa học: Structure, mRNA expression and linkage mapping of the brain-type fatty acid-binding protein gene (fabp7 ) from zebrafish (Danio rerio) potx
... gggaGGCGgggctt ttcatCCAAtca ctaaAATTacagtgt atcaatATGCtaata aacatatgTAATaata aggtAATTacaatga ttgattttAAATaaac ATAAtttttaaaca aATGCaaaaa aaatATTCaa cATGCcaatt aatCCAAtaac ccaCCAAtatc tcaCCAAttga ... tcaCCAAttga aggacCCAAtaaggga agcGATAtta taaaGATAaacaa taagaGATAatcgg attaCAATtg caaaCAATgc aagaCAATaa cgaaCAATtt caaaCAATtt TGACgttt aaTGACtaatt atTGACtgaaa ctgaGTCAg Ó FEBS 2003 localized to the adult ... synthesized based on the linker sequence (C1: 5¢-GTAC ATATTGTCGTTAGAACGCGTAATACGACTCA-3¢; C2: 5¢-CGTTAGAACGCGTAATACGACTCACTATA GGGAGA-3¢) First round PCR was performed using primer C1 and an...
- 11
- 366
- 0
cross plane electronic and thermal transport properties of p type la0.67sr0.33mno3 lamno3 perovskite oxide metal semiconductor superlattices
... amplifier that measured the amplitude and phase shift of the pressure signal The measured signal was then related to thermal properties of the sample using a heat conduction model.27 A detailed discussion ... for all layers of the superlattice In order to determine the degree of relaxation and strain in the superlattice layers, reciprocal space mapping (RSM) of the oxide superlattices was performed A ... magnetoresistance in a layered manganite crystal,” Science 274, 1698 (1996) 30 Y Moritomo, A Asamitsu, H Kuwahara, and Y Tokura, “Giant magnetoresistance of manganese oxides with a layered perovskite...
- 8
- 461
- 0
Báo cáo sinh học: " Attenuation and efficacy of human parainfluenza virus type 1 (HPIV1) vaccine candidates containing stabilized mutations in the P/C and L genes" potx
... preparations Evaluation of the two vaccine candidates revealed that they are reasonable candidates for further study in clinical trials Both candidates replicated well in Vero cells, a characteristic ... to Pamela Shaw and Dean Follman for assistance with statistical analysis We also thank Brad Finneyfrock and Marisa St Claire at Bioqual Inc for carrying out the primate studies This project was ... virus vaccine for HPIV1 for intranasal administration to infants and young children The intranasal route of administration is needle-free and has the advantage of direct stimulation of local immunity...
- 13
- 504
- 0
Báo cáo hóa học: " Attenuation and efficacy of human parainfluenza virus type 1 (HPIV1) vaccine candidates containing stabilized mutations in the P/C and L genes" docx
... preparations Evaluation of the two vaccine candidates revealed that they are reasonable candidates for further study in clinical trials Both candidates replicated well in Vero cells, a characteristic ... to Pamela Shaw and Dean Follman for assistance with statistical analysis We also thank Brad Finneyfrock and Marisa St Claire at Bioqual Inc for carrying out the primate studies This project was ... virus vaccine for HPIV1 for intranasal administration to infants and young children The intranasal route of administration is needle-free and has the advantage of direct stimulation of local immunity...
- 13
- 520
- 0
báo cáo hóa học:" Factors associated with psychological and behavioral functioning in people with type 2 diabetes living in France" pptx
... in dialysis or have you had a kidney transplantation?”); at least one macrovascular complication ("Has a doctor told you that you have had a myocardial infarction, angina?”, “Have you Medical reimbursements ... database Statistical Analysis All descriptive statistics were presented as means and standard deviations for continuous variables, and as absolute and relative frequencies for categorical variables ... Surprisingly, compared to the impact of microvascular complications, the effect of macrovascular complications was limited (about a 3-decrease only in the BA dimension) Macrovascular disease was defined...
- 8
- 470
- 0
- the layout of a web page
- what contains the layout of the frames on a web page
- what features affect the layout of a web page
- designing the layout of a web page
- what is the role of electrical engineer in steel plant
- the endosperm in the seed of a flowering plant is triploid
- towards a general theory of the balance of payments
- example of the general form of the equation of a line in standard form
- 1intelligent multi information sensing and fusion in the manufacturing process
- materials parts and the manufacturing processes
- control and monitoring of food manufacturing processes
- functions apos evolution and the process structure in a steel plant
- the steel plant should represent the concepts about quot flow quot material flow and mass flow to be the core
- the general layout of modern steel plant should represent the progress of manufacturing process
- computer system validation controlling the manufacturing process
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc đặc tuyến hiệu suất h fi p2 sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25