e virus gây bệnh sởi
Thuyết trình virus có hại
... Papovaviridae Hình khối 20 mặt Virus Palyoma(ung thư tử cung ) Không Kháng 45-55 Adenoviridae Hình khối 20 mặt Virus adeno Không Kháng 80-110 Herpesviridae Hình khối 20 mặt HSV-1, HSV-2, CMV, EBV Có ... trị chủ yếu Interferon alpha Interferon alpha chất tự nhiên có thể người, sản xuất số tế bào thể nhiễm virut Chức Interferon alpha diệt trừ tác nhân gây bệnh Như vậy, dùng Interferon, siêu vi ... thuốc thời gian * VIRUS VIÊM GAN E HEV •Theo WHO sauY tếnhiễmgiới (WHO) VGSV E Theo Tổ chức Thế vi-rút triệu chứng VGSV E phát triển từ đến tuần với thời gian ủ bệnh loại bệnh nhiễm thường lây...
Ngày tải lên: 04/08/2015, 12:16
Tách dòng và thiết kế vector chuyển gen của gen mã hoá protein vỏ (coat protein) từ virus gây bệnh đốm vòng cây đu đủ (PRSV) ở việt nam
... từ gen PRSVN V.MSKTEAVDAGLNEKLKEKEKQKEKEKEKDKQKDKDNDGASDGNDVSTSTKTGERDRDV NAGTSGTFTVPRIKSFTDKMILPRIKGKSVLNLNHLLQYNPKQIDISNTRATQSQFEKWY EGVRNDYGLSDNEMQVMLNGLMVWCIENGTSPDISGVWVMMDGETQVDYPIKPLIEHATP ... dịch mã từ gen nh2nh5 EKLKEKEKQKEKEKEKDKQKDKDNDGASDGNDVSTSTKTGERDRDVNAGTSGTFTVPRIK SFTDKMILPRIKGKSVLNLNHLLQYNPKQIDISNTRATQSQFEKWYEGVRNDYGLSDNEM QVMLNGLMVWCIENGTSPDISGVWVMMDGETQVDYPIKPLIEHATPSFRQIMAHFSNAAE ... tận tù với trình tự nucleotide đặc trng xác định 1.3.2.5 Enzim Mung-bean nuclease 21 Mung-bean nuclease đợc tinh chế từ mầm đậu xanh (mung bean) có hoạt tính nuclease Enzim cắt sợi RNA sợi đơn...
Ngày tải lên: 30/10/2012, 14:53
Đánh giá tính đa dạng của các virus gây bệnh xoan lá cà chua ở Việt Nam thong qua tách dòng, xác định và so sánh trình tự đoạn gen mã hóa cho protein vỏ
... 28 Polston J .E. , Anderson P.K (1997), The emergence of whitefly-transmitted geminiviruses in tomato in the Western Hemisphere, Plant Disease, 81, pp 1358-1369 29 Revington G.N., Sunter G., Bisaro ... Kochieva E. Z., Ryzhova N.N., Khrapalova I.A., Pukhalskyi V.A (2000), Genetic Diversity ADN Phylogenetic Relationships in the Genus Lycopersicon (Tourn.) Mill as Revealed by Inter-Simple Sequence ... 13966-13974 16 Fire A., Xu S., Montgomery M.K., Kostas S.A., Driver S .E, Mello C.C (1998), Potent ADN specific genetic interference by double-stranded RNA in Caenorhabditis elegans, Nature, 391, pp...
Ngày tải lên: 30/10/2012, 14:53
Tách dòng, xác định và so sánh trình tự gen mã hoá Nuclear Inclusion Body protein (NIb) của một số dòng virus gây bệnh đốm vòng trên cây đu đủ (Papaya Ringspot virus-PRSV) ở Việt Nam
... template-dependent and specific viral RNA polymerase obtained by a new procedure, J Virol Methods, 64(2), pp 181-195 21 Ehrenfeld N., Romano E. , Serrano C., Arce-Johnson P (2004), Replicase mediated ... double- strand RNA viruses as viewed through their RNA-dependent RNA polymerases, Nucleic acids Res, 19, pp 217-226 18 Schubert J., Matousek J., Mattern D (2004), Pathogen-derived resistance in ... seed-borne mosaic potyvirus in transgenic peas expressing the viral replicase (NIb) gene, J Gen Virol, (790), pp 3129-3137 32 Koonin E. V (1991), The phylogeny of RNA-dependent RNA polymerase of possitive-strand...
Ngày tải lên: 30/10/2012, 15:03
Khảo sát một số phương pháp tăng sinh khối giống tảo Spirulina platensis qui mô phòng thí nghiệmXác định thành phần Protein của virus gây bệnh Hội chứng đốm trắng
... Gel Electrophoresis 17 Sf9: Sepodoptera frugiperda 18 TEMED: N, N, N, N tetramethylethylenediamine 19 TCID50: Tissue Culture Infection Dose 20 VP28: Envelope protein (28kDa) 21 VP26: Nucleocapsid ... white shrimp (Penaeus vannamei) Red claw freshwater crayfish (Cherax quadricarinatus) Blue shrimp (Penaeus stylirostris) Green tiger prawn (Penaeus semisulcatus) (Ngun: http://www.diseasewatch.com/documents/CD/index/html/cv035sph.htm) ... Open Reading Frame 12 PAb: Polyclonal Antibody 13 PBS: Phosphate Buffered Saline 14 PCR: Polymerase Chain Reaction 15 PEG: Polyethylene glycol 16 SDS-PAGE: Sodium Dodecylsulfate Polyacrylamide...
Ngày tải lên: 01/11/2012, 10:41
Nghiên cứu tạo cây dứa cayenne in vitro sạch virus gây bệnh héo đỏ đầu lá
... tip, especially heat treatment at 370C in 30 days was also studied The experiment result showed that meristem regeneration was mainly influenced by the size of the excised tissue Meanwhile, the ... growth of the regenerative shoots were influenced by cultivar factors Heat treatment did not considerably influence on the regeneration and subsequent growth of propagated meristem All samples (3/3) ... involving heat treatment followed by meristem culture and simply meristem culture were used to eliminate PMWaV-1 and PMWaV-2 from in vitro PMWaV infected pineapple plants Three Smooth Cayenne cultivars...
Ngày tải lên: 05/11/2012, 14:00
Nghiên cứu virus gây bệnh trên cây ớt tại huyện củ chi , Tp.Hồ chí minh bằng kĩ thuật ELISA
... (Avian Myeloblastosis Virus) Reverse Transcriptase MMLV (Moloney Murine Leukemia Virus) Reverse Transcriptase Cả hai loại enzyme cần primer để khởi đầu việc tổng hợp AMV Reverse Transcriptase DNA ... Sandwich Enzyme Linked Immuno Sorbent Assay - DEPC: Diethyl pyrocarbonate -dNTP: Deoxyribonucleoside triphosphate - M-MLV: Moloney murine leukemia virus - MP: movement protein - OD: Optical Density ... University has finished the thesis for months (3-8/2006) The thesis entitled: “Research on viruses (TMV, CMV) causing diseases on pepper at Cu Chi District, Ho Chi Minh City using ELISA technique...
Ngày tải lên: 05/11/2012, 14:00
Các virus gây bệnh - các virus họ herpesviridae.
... virus học - Virus Dengue thuộc họ Flaviviridae, gồm có type huyết virus Dengue gây bệnh cho người: Virus Dengue type 1, virus Dengue type 2, virus Dengue type virus Dengue type - Virus Dengue ... yếu, chăm sóc bệnh nhân, nâng cao thể trạng, hạn chế di chứng II VIRUS DENGUE Virus Dengue tác nhân gây bệnh sốt Dengue cổ điển bệnh sốt xuất huyết Dengue (SXHD) Bệnh virus Dengue gây có nhiều ... lớn đoạn gen gag mã hoá cho tổng hợp cho protein cấu trúc lõi virus, gen pol mã hoá cho hình thành protein enzyme virus ( integrase, reverse transcriptase/RNase, protease) đoạn gen env mã hoá...
Ngày tải lên: 17/11/2012, 09:13
Nghiên cứu sugarcane yellow leaf virus gây bệnh vàng gân lá trên mía bằng kính hiển vi huỳnh quang và kỹ thuật rt-pcr
... pathogen of economic importance The disease has been reported to occur in many sugarcane growing area worldwide Sugarcane yellow leaf virus resides in the phloem of diseased canes Symptoms of the ... plants expressing disease symptom, the vascular bundles presented fluorescence in the phloem while symtomless plants not have fluorescence - Finding out the RT-PCR process that can be used for ... the disease generally appear in maturing plant as a yellowing of the leaf midrib The disease can be diagnosed by symptoms, RTPCR, ELISA, TBIA, ISEM, EM or fluorescence microcopy The objectives of...
Ngày tải lên: 17/11/2012, 09:44
Nghiên cứu tạo cây dứa Cayenne in Vitro sạch Virus gây bệnh héo đỏ đầu lá
... tip, especially heat treatment at 370C in 30 days was also studied The experiment result showed that meristem regeneration was mainly influenced by the size of the excised tissue Meanwhile, the ... growth of the regenerative shoots were influenced by cultivar factors Heat treatment did not considerably influence on the regeneration and subsequent growth of propagated meristem All samples (3/3) ... involving heat treatment followed by meristem culture and simply meristem culture were used to eliminate PMWaV-1 and PMWaV-2 from in vitro PMWaV infected pineapple plants Three Smooth Cayenne cultivars...
Ngày tải lên: 17/11/2012, 09:44
Phân lập vi khuẩn Bacillus subtilis trong phân heo và thử đối kháng với e.coli gây bệnh tiêu chảy trên heo
... TẮT ETEC : Enterotoxigenic E coli EAEC : Enteroaggregative E coli LT : Heat-labile toxin ST : Heat-stable toxin CT : Cholera enterotoxin EAST : Enteroaggreative stable-toxin ENS : Enteric nervous ... E coli với tế bào thành ruột chia chủng E coli gây bệnh thành loại: enterotoxigenic E coli (ETEC), enterohemorrhagic E coli (EHEC), enteroaggregative E coli (EAEC), enteropathogenic E coli (EPEC), ... transposome hay phage Trong loại enterotoxigenic E coli loại phổ biến gây bệnh heo 2.2 Enterotoxigenic E coli (ETEC) Enterotoxigenic E coli chủng vi khuẩn có khả tiết thành viên trong loại độc tố enterotoxin...
Ngày tải lên: 17/11/2012, 09:45
Phân lập vi khuẩn bacillus subtilis từ đất và khảo sát tính đối kháng với vi khuẩn E.coli gây bênh tiêu chảy trên heo
... TẮT E coli Escherichia coli B subtilis Bacillus subtilis E. P .E. C Enteropathogenic Escherichia coli E. I .E. C Enteroinvasive Escherichia coli E. H .E. C Enterohaemorrhagic Escherichia coli E. Agg .E. C Enteroaggregative ... 2: Antagonism between centrifuged cell– free extract of Bacillus subtilis culture and E coli in TSA plates Experiment result showed that: the inhibitory efficiency of cell-free extract of Bacillus ... E. Agg .E. C Enteroaggregative Escherichia coli E. T .E. C Enterotoxingenic Escherichia coli LT Heat labile enterotoxin ST Heat stable enterotoxin TSA Trypticase Soya Agar TSB Trypticase Soya Broth...
Ngày tải lên: 17/11/2012, 09:45
Phát hiện và định lượng virus gây bệnh đốm trắng trên tôm sú bằng kỹ thuật Real - time PCR
... (PCR) + (PCR) + (Semi-Nested PCR) + (Semi-Nested PCR) + (Semi-Nested PCR) + (Semi-Nested PCR) - (PCR) - (PCR) - (Semi-Nested PCR) - (Semi-Nested PCR) Non Stop Nested PCR Real - time PCR + + + + + ... huỳnh quang: ethidium bromide, SYBR Green I - Probe đặc hiệu có gắn chất phát huỳnh quang: TaqMan probe, Fluorescence Resonance Energy Transfer (FRET) probe, Molecular Beacons probe, Scorpions ... Disease - WSS: White Spot Syndrome - WSV: White Spot Virus - SEMBV: Systemic Ectodermal and Mesodermal Baculovirus Disease - HHNBV: Hypodermal and Haematopoietic Necrosis Baculovirus Hiện nay, WSSV...
Ngày tải lên: 17/11/2012, 09:45
Nghiên cứu sugacane yellow leaf virus gây bệnh vàng gân lá trên mía
... pathogen of economic importance The disease has been reported to occur in many sugarcane growing area worldwide Sugarcane yellow leaf virus resides in the phloem of diseased canes Symptoms of the ... plants expressing disease symptom, the vascular bundles presented fluorescence in the phloem while symtomless plants not have fluorescence - Finding out the RT-PCR process that can be used for ... the disease generally appear in maturing plant as a yellowing of the leaf midrib The disease can be diagnosed by symptoms, RTPCR, ELISA, TBIA, ISEM, EM or fluorescence microcopy The objectives of...
Ngày tải lên: 19/11/2012, 15:17
Các virus gây bệnh - các virus họ herpesviridae
... virus học - Virus Dengue thuộc họ Flaviviridae, gồm có type huyết virus Dengue gây bệnh cho người: Virus Dengue type 1, virus Dengue type 2, virus Dengue type virus Dengue type - Virus Dengue ... yếu, chăm sóc bệnh nhân, nâng cao thể trạng, hạn chế di chứng II VIRUS DENGUE Virus Dengue tác nhân gây bệnh sốt Dengue cổ điển bệnh sốt xuất huyết Dengue (SXHD) Bệnh virus Dengue gây có nhiều ... lớn đoạn gen gag mã hoá cho tổng hợp cho protein cấu trúc lõi virus, gen pol mã hoá cho hình thành protein enzyme virus ( integrase, reverse transcriptase/RNase, protease) đoạn gen env mã hoá...
Ngày tải lên: 01/03/2013, 17:04
tách dòng và thiết kế vector chuyển gen mã hóa protein vỏ từ virus gây bệnh đốm vòng cây đu đủ ở Việt Nam
... mã từ gen PRSVN V.MSKTEAVDAGLNEKLKEKEKQKEKEKEKDKQKDKDNDGASDGNDVSTSTKTGERDRDV 60 NAGTSGTFTVPRIKSFTDKMILPRIKGKSVLNLNHLLQYNPKQIDISNTRATQSQFEKWY 120 EGVRNDYGLSDNEMQVMLNGLMVWCIENGTSPDISGVWVMMDGETQVDYPIKPLIEHATP ... EGVRNDYGLSDNEMQVMLNGLMVWCIENGTSPDISGVWVMMDGETQVDYPIKPLIEHATP 180 SFRQIMAHFSNAAEAYIAKRNATERYMPRYGIKRNLTDISLARYAFDFYEVNSKTPDGAR 240 EAHMQMKAAALRNTSRRMFGMDGSVSNKEENTERHTVEDVNRDMHSLLGMRN.ILALVCL 300 EL 302 Trình tự nucleotide gen nh2nh5 (gen CP) ... dịch mã từ gen nh2nh5 EKLKEKEKQKEKEKEKDKQKDKDNDGASDGNDVSTSTKTGERDRDVNAGTSGTFTVPRIK SFTDKMILPRIKGKSVLNLNHLLQYNPKQIDISNTRATQSQFEKWYEGVRNDYGLSDNEM QVMLNGLMVWCIENGTSPDISGVWVMMDGETQVDYPIKPLIEHATPSFRQIMAHFSNAAE...
Ngày tải lên: 19/03/2013, 08:21
Đánh giá tính đa dạng của các virus gây bệnh xoan lá cà chua ở Việt Nam thong qua tách dòng, xác định và so sánh trình tự đoạn gen mã hóa cho protein vỏ
... 28 Polston J .E. , Anderson P.K (1997), The emergence of whitefly-transmitted geminiviruses in tomato in the Western Hemisphere, Plant Disease, 81, pp 13581369 29 Revington G.N., Sunter G., Bisaro ... Kochieva E. Z., Ryzhova N.N., Khrapalova I.A., Pukhalskyi V.A (2000), Genetic Diversity ADN Phylogenetic Relationships in the Genus Lycopersicon (Tourn.) Mill as Revealed by Inter-Simple Sequence ... 13966-13974 16 Fire A., Xu S., Montgomery M.K., Kostas S.A., Driver S .E, Mello C.C (1998), Potent ADN specific genetic interference by double-stranded RNA in Caenorhabditis elegans, Nature, 391, pp...
Ngày tải lên: 19/03/2013, 08:21