cellular analysis of tdrl 505 9a h460 cells were treated for 48 hours with increasing concentrations of tdrl 505 as indicated in the figure cells were then analyzed for annexin v and pi content represented by the x and y axis respe
Báo cáo khoa học: Analysis of Lsm1p and Lsm8p domains in the cellular localization of Lsm complexes in budding yeast ppt
... Beads were mixed with extracts and incubated for h at °C and washed with lysis buffer For northern analysis, beads were phenol ⁄ chloroform extracted and resolved by denaturing PAGE (6%) For western ... not determined by any single feature, and has proved useful in determining the relative contributions of various domains for their localization Further examination of the specific effects these mutants ... [24] performed extensive mutational analysis of Lsm1p showing the importance of residues proposed to be involved in RNA binding and complex formation, and of the C-terminal region for the func-...
- 16
- 515
- 0
An Analysis of Business Administration Students Interest in the area of production and Operations pot
... Production and operations provided a more specific base for the analysis The fifth and final dimension involved an assessment of the ‘perception of the necessity’ including the area of Business Administration ... previously defined expectations The variables used in the research were grouped by construct, and then means and standard deviations were calculated (the Appendix presents the variables and the ... student interest in the area; Proposition P4, which stated that the level of personal interest of the student in the area is positively influenced by the perception of the necessity of the area in the...
- 13
- 469
- 0
báo cáo hóa học:" Microarray analysis of Foxl2 mediated gene regulation in the mouse ovary derived KK1 granulosa cell line: Over-expression of Foxl2 leads to activation of the gonadotropin releasing hormone receptor gene promoter" pptx
... promoter was determined by comparing the luciferase activity of the promoter in the presence of pFoxl2 (over-expression) to the activity of the promoter in the absence of Foxl2 over-expression ... characterized by eyelid malformation and POF suggesting that the expression of FoxL2 is critical in the developing eyelid as well as in the maintenance of ovarian function Foxl2 has also been implicated in ... promoter in pituitary derived aT3-1 cell line based on activation by the Foxl2-VP16 fusion protein [9] Foxl2-VP16 action was directed by binding to the GRAS element with the potential for complex formation...
- 12
- 561
- 0
Báo cáo y học: "Analysis of immunoglobulin light chain rearrangements in the salivary gland and blood of a patient with Sjögren’s syndrome" pptx
... a typical histology of the minor salivary glands (focus score >1) The duration of the disease was years at the time of analysis The patient expressed elevated titers of anti-52 kDa Ro(SS-A) and ... predominantly in the productive and nonproductive repertoires of the peripheral blood (85 and 89%, respectively), and exclusively in nonproductive rearrangements and in 80% of the productive rearrangements ... V A19 and V 2E as well as V 1C being preferentially expanded Since these VL genes were not found to be over -represented in the nonproductive VL gene repertoire of the parotid gland, they appeared...
- 12
- 441
- 0
báo cáo khoa học: "Transcriptional analysis of cell growth and morphogenesis in the unicellular green alga Micrasterias (Streptophyta), with emphasis on the role of expansin" pot
... GPSAKAKHTHFDLSGAAFGHMAIPGHNGVIRNRGLLNILYRRTAC * * : : * : : * W W W PKMDGGVVFNVSV-ASASYMQVVVQNVGG -WAGSLAS-RLPPM PQMVGGVQFNVSV-ASVAYMQVLIQNVGGMGRLTQVFASADGV-KFFPMYRNYGSVWAIN -RTAGGVQFVVQS-GNQYYFAVLIQNVGGPGSLQAVAVSTNGR-TFQLMTRSYGAVWQVS ... -RTAGGVQFVVQS-GNQYYFAVLIQNVGGPGSLQAVAVSTNGR-TFQLMTRSYGAVWQVS QRAGG-VQFKVLV-GNPYYLEVLISNVAGSVDLAKVEVLVQGVGYWQPMKHDYGAVYSIS VRRGG-IRFTIN GHSYFNLVLITNVGGAGDVHSAMVKGSRT-GWQAMSRNWGQNWQ-S KYRGKNIAFHVNAGSTDYWLSLLIEYEDGEGDIGSMHIRQAGSKEWISMKHIWGANWCIV ... Md3598 was the a-1,6-xylosyltransferase, typical of the hemicellulose biosynthetic pathway, whereas Md0888 was the xyloglucan endotransglycosylase/hydrolase (XET/XTH) that is a xyloglucan-modifying...
- 17
- 562
- 0
Báo cáo y học: " Molecular analysis of HBV genotypes and subgenotypes in the Central-East region of Tunisia" potx
... results were provided by TSP-PCR: only two genotypes, D and A, were detected in 96% and 4% of the samples, respectively Concordance with PCR-RFLP was found in 93% of the cases (121/130) The nine cases ... (6%) in the Pre-S region of HBV genome, as described by Lindh et al [7] The sensitivity of this method was previously estimated to be 103 copies/ml Two genotyping methods were used: - RFLP analysis ... accurate for genotypic determination than the pre-S gene amplified by PCR-RFLP [26,27] The bias observed between the two PCR based methods could then be simply due to the region used for genotyping In...
- 6
- 412
- 0
Báo cáo y học: " Analysis of repetitive DNA distribution patterns in the Tribolium castaneum genome" pptx
... putative heterochromatic intervals along each chromosome is random Intervals defined as putative heterochromatin by the above analysis were denoted by and euchromatin by The distribution of these intervals ... belonging to the Y must be contained within the 'unknown' file Before beginning our analysis, we assessed the accuracy of each chromosome build by verifying the location of each marker Several ... 93% of the reverse transcriptases and 83% of the transposases in the TEpipe libraries were masked by RepeatScout In contrast, when we used the TEpipe libraries to mask the RepeatScout library,...
- 14
- 336
- 0
Analysis of p13k independent survival pathways in the prostate cancer cell line LN cap 1
... contains binding domains for p85 subunit and Ras and a phosphatidylinositol kinase domain The p85 and p110 subunit tightly associate with each other in the cytoplasm as a preformed complex even in their ... cleavage sites on the procaspases are themselves Asp -X sites, indicating that caspases are capable of being activated by autoproteolysis Indeed caspases involved in apoptosis can be divided into ... and activation of the receptors’ intrinsic tyrosine kinase activity; and concomitant autophosphorylation of conserved tyrosine residues within its cytoplasmic region The phosphorylated tyrosine...
- 140
- 283
- 0
Analysis of p13k independent survival pathways in the prostate cancer cell line LN cap 2
... proteins involved in cellular signaling, the intracellular prooxidant milieu created by ROS has been shown to block the protease activity of the main apoptosis executioner, caspase-3, by oxidative ... and may help in development of a prognostic indicator Also 173 better understanding the regulation of Bad by various survival signaling pathways and the relevant survival factors involved may ... of tyrosine kinase inhibitors that function by blocking the ATP acceptor site (lysine 721) located within the receptor’s intracellular kinase domain (Levitzki and Gazit 1995) The EGFR kinase inhibitor,...
- 117
- 325
- 0
Molecular analysis of maternal diabetes induced changes in the developing neural tube
... in e A III LV E B dc dc e vtw vtw E C vt dt D Fig Thickness of Ventral Telencephalon Wall (µm) 300 250 * 200 150 100 50 Fig Control Diabetic vt dt vt vt A B Fig % of BrdU -cells in Ventral ... dc vt A Fig vt B e A Fold of induction 3.5 ** 2.5 1.5 0.5 Control Diabetic B 333bp C Fig dc dc III vt A vt B LV A Fig dc e dc III vt vt LV A Fig dt B III e e e dc vt LV A Fig 10 B A Fold of induction ... 325bp C Fig 11 e dc e dc vt vt dmt dt A Fig 12 B * A Fold of induction 1.4 1.2 0.8 0.6 0.4 0.2 Control Diabetic B 238bp C Fig 13 A Fig 14 B C B III III A B ctx LV LV LV LV cn C D III III III E...
- 19
- 180
- 0
The Science Of Getting Rich - As Featured In The Best-Selling''''secret'''' By Rhonda Byrne pdf
... rich by studying poverty and thinking about poverty Medicine as a science of disease has increased disease; religion as a science of sin has promoted sin, and economics as a study of poverty will ... away with poverty What tends to away with poverty is not the getting of pictures of poverty into your mind, but getting pictures of wealth into the minds of the poor You are not deserting the ... not being "kept down" by their masters; they are not being "ground" by the trusts and combinations of capital As a class, they are where they are because they not things in a Certain Way If the...
- 77
- 587
- 1
ANALYSIS OF MICROBIAL COMMUNITY STRUCTURE AND IN SITU ACTIVITY OF NITRIFYING BIOFILMS
... diversity of ammonia-oxidizing bacteria The phylogenetic microbial diversity of two types of nitrifying biofilms, a domestic wastewater and an autotrophic nitrifying biofilms, were determined by ... distributions of in situ nitrifying activities were determined The relationship between the spatial organization of nitrifying bacterial populations and the in situ activity of these populations within the ... community within an autotrophic nitrifying biofilm After reaching the steady-state condition, microprofiles of NH4+, NO2-, NO3-, and O2 in the biofilms were measured by use of microsensors, and the...
- 10
- 712
- 0
Spatial moment analysis of colloid facilitated radionuclide transport in a coupled fracture-matrix system
... moment with time provides the velocity of the radionuclide It is observed from Figure that the velocity of the radionuclide has significantly reduced nearer to the source The velocity further reduces ... the early stages the velocity of radionuclides is relatively higher when the fluid velocity is high (V = 100 m/year) but as time progresses the velocity profiles merge with each other as the concentration ... radionuclides; one for the fracture, and another for the rock-matrix, formulated for a one-dimensional framework The continuity at the fracture-matrix interface is attained by iterating the solution...
- 14
- 476
- 0
A contrastive analysis of metaphorical lexis and collocation in english and vietnamese economics discourse
... from the field of capital, such as stored value, investment and rates of return, to the analysis of the labour market, whereby education, training and experience are seen as investments increasing ... The expression of increase and decrease Expressions of increase and decrease are very common in economics texts of many types, and the language used to express these concepts often seems to involve ... comparability Secondly, the two text types chosen stand out for their frequent use of lexis to express notions of increase and decrease The English texts used were minutes of the meetings of the Monetary...
- 33
- 1,109
- 3
An analysis of nouns formed by suffixes in english a case study of the textbook solutions pre intermedite
... “An analysis of nouns formed by suffixes in the texts in the textbook “Solutions-pre-intermediate” There are two survey questionnaires and the following are the analysis reports a/ The survey for ... That is the main content of the texts The following is the analysis of the nouns formed by suffixes used in the text When a word is analyzed, it shows the roots and the suffixes which create the ... actors who have played the part of Bond That is the main content of the text The following is the analysis in detail of the nouns formed by suffixes which are used in this text - British: the people...
- 63
- 988
- 3
Reliability analysis of a power system based on the multi state system theory
... RELIABILITY ANALYSIS OF THE POWER SYSTEM The reliability of the power system is analyzed using the multi-state system theory According to (2), the universal generating function of the battery is: ... conservative For example, when the required capacity is 23.4 Ah, the reliability of the system obtained by the traditional system reliability theory is only 0.25107, but the reliability of the system ... reliability of the power system obtained by the traditional system reliability theory is always conservative [5] (2) The power system is a multi-state system The multistate system theory can define the...
- 4
- 407
- 0
Tài liệu Transformation through Integration An Activity Theoretical Analysis of School Development as Integration of Child Care Institutions and the Elementary School ppt
... gradually replaced by didactic toys and developmental psychology The Barnstugeutredningen inquiry in the early seventies was the crowning achievement in this development towards individualization and ... begging on the streets and disturbing the peace (Sandin, 1986) At this time the population was growing, poverty was huge, and criminality was widespread In the beginning the elementary school system ... mathematics and geometry, and the design of the Spielgaben was based on principles from these fields The Spielgaben were inspired by nature and produced by natural material, such as balls and...
- 336
- 322
- 0
Tài liệu Báo cáo khoa học: Molecular and cellular specificity of post-translational aminoacyl isomerization in the crustacean hyperglycaemic hormone family docx
... N-terminal cyclized L-CHH and L-VIH cells secrete exclusively CHH and VIH, respectively, whereas D-CHH and D-VIH cells release mainly the D-isomer of the respective hormone, in addition to a variable ... parts of the d-CHH cells, in decreasing amounts from the cell body to the axon terminal in the sinus gland, as a result of late and progressive isomerization of the Phe3 of the CHH during the migration ... immunohistochemistry revealed that strong immunostaining of CHH and VIH may coincide with a weak or null mRNA labelling and vice versa [26] The existence of a sixth type of cell, producing a mixture of l-epimers...
- 13
- 687
- 0
Tài liệu ADVANCES IN QUANTITATIVE ANALYSIS OF FINANCE AND ACCOUNTING Essays in Microstructure in Honor of David K. Whitcomb Volume 3 ppt
... this measure In “Intraday Volatility on the NYSE and NASDAQ”, Daniel Weaver examines differences in intraday volatility between stocks trading on the NYSE and NASDAQ under stable as well as stressful ... The analysis is carried out only for the special case of linear demand curves of traders and the special cost function arising out of private information and inventory costs As before, we have ... content. tex viii Contents Chapter Intraday Volatility on the NYSE and NASDAQ Daniel G Weaver Chapter The Intraday Probability of Informed Trading on the NYSE Michael A Goldstein, Bonnie F Van Ness,...
- 269
- 1,126
- 0
Báo cáo khoa học: Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A and fibronectin-binding protein B from Staphylococcus aureus pot
... effect of the proximities of the antibody-binding and Fn-binding sites, the interaction of the repeat with Fn may be sterically hindered in the presence of the antibody The results of this study allow ... colonization and invasion Deletion of the Fn-binding proteins from S aureus is associated with a poorly adhesive, noninvasive phenotype [31] It is believed that the ability of S aureus to invade the host ... using amine coupling chemistry This was performed by activating the surface for with a mixture of 1-ethyl-3-(3-dimethylaminopropyl)-carbodiimide (0.2 m) and sulfo-NHS (0.05 m), and then injecting...
- 16
- 560
- 0
- analysis of biological networks wiley series in bioinformatics
- what are the goals of school inspection as specified in the national policy on education
- what are the goals of population education as outlined in the national policy on education
- a critical discourse analysis of verbal expressions showing emotions in football commentaries in english and vietnamese enewspapers
- chapter 7 contains a longitudinal analysis of the subset of companies that had participated in the previous study collis 2003 as well as the present survey
- thermal analysis of phase transitions and crystallization in polymeric fibers
- a game theoretic analysis of price qos market share in presence of adversarial service providers
- chromatin immunoprecipitation based analysis of gene regulatory networks operative in human embryonic stem cells
- analysis of dnase i hypersensitivity sites in the cd3g cd3d gene region
- effect of tdrl 505 on a549 nsclc cells 10a a549 cells were treated for 48 hours with increasing concentrations of tdrl 505 as indicated in the figure cells were then analyzed for pi and annexin v staining using flow cytometry pi an
- tdrl 505 acts synergistically with cisplatin and etoposide h460 cells were treated with increasing fractions of the ic50 concentration of either cisplatin or etoposide with tdrl 505 for 48 hours following treatment cells were harveste
- a fluorescence images of the glass beads after silanization at different apes concentrations as indicated in the numbers below the scale bar is
- a fluorescence images of the glass beads after immobilization of glyphosate at different glyphosate concentrations as indicated in the numbers b
- gt compounds in the independent validation set chemical name and relevant chemical abstracts service cas number of these compounds are shown in the figure
- seven structures of misclassified gt compounds in the independent validation set chemical name and relevant chemical abstracts service cas number of these compounds are shown in the figure
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25