2 đề đáp án biểu điểm

cloud standardsa

Ngày tải lên : 27/10/2014, 00:33

... out that there are impairments that the guidelines cannot www.w3.org/TR /20 02/ REC-UAAG10 -20 021 217/intro.html#limitations 25 26 Chapter | Standards address and are therefore out of scope Leaving ... together and often release IT standards jointly under the designation the ISO/IEC See Figure 2- 2 below Figure 2- 2 Standards organization can be arranged in international and national hierarchies The ... DSP-ISO1 02, June 18, 20 10, http://dmtf.org/sites/default/files/standards/documents/ DSP-IS01 02_ 1.0.0.pdf; DMTF, “Use Cases and Interactions for Managing Clouds,” DSP-ISO103, June 18, 20 10, http://dmtf.org/sites/default/files/standards/documents/DSP-IS0103_1.0.0.pdf...

370
627
0

Evolution of the Earth and its Atmosphere and its Atmosphere

Ngày tải lên : 04/04/2013, 10:51

... Cl2 + 2O3 → 2ClO + 2O2 and 2ClO + O2 → Cl2 +2O2 Danger in the Air Nitrous Oxide (N2O) ♦ In the last 20 0 years, nitrous oxide concentrations in the atmosphere have increased by 10%, from about 28 0 ... Crust Mantle SiO2 & misc other SiO2 MgO FeO Fe2O3 Al2O3 CaO Fe Ni Si Core 30 20 6 2 24 4 Total % 66 32 The Earth and its Atmosphere Today Atmospheric Composition (excluding H 2O) Gas Formula ... and“Equation” its Atmosphere Disassociation of NH3 2NH3 + uv → N2 + 3H2 Conversion of some H2O and most CO H2O + CO + sunlight → H2 + CO2 (As most H2O condensed to create the oceans, rain, erosion...

18
517
0

Tài liệu Báo cáo khoa học: Topology, tinkering and evolution of the human transcription factor network doc

Ngày tải lên : 19/02/2014, 07:20

... BRIP1, pRB, p130, DP-1, DP -2, E2F-1, E2F -2, E2F-3, p107, E2F-4, E2F-5, E2F-6, HDAC3, HDAC1, HDAC2, YAF2, ADA3, BRCA1, WT1, 53BP1, PML-3, MTA1-L1, BAF47, p53, YY1, TGIF, GATA -2, HDAC5 TFIIA-ab precursor(major), ... (20 00) Arabidopsis transcription factors: genomewide comparative analysis among eukaryotes Science 29 0, 21 05 21 10 FEBS Journal 27 2 (20 05) 6 423 –6434 ª 20 05 The Authors Journal compilation ª 20 05 ... suggestions in manuscript preparation This work was supported by grants SAF20 02- 025 86, FIS2004-05 422 , P 225 6704 and CVI -26 7 group (Andalusian Government), a MECD fellowship (CRC) and by the Santa...

12
511
0

Tài liệu Báo cáo khoa học: cN-crystallin and the evolution of the bc-crystallin superfamily in vertebrates pdf

Ngày tải lên : 19/02/2014, 17:20

... genes FEBS Journal 27 2 (20 05) 22 76 22 91 ª 20 05 FEBS 99 zfbA1-1 mbA1 94 βA zfbA4 98 66 mbA4 64 zfbA2 β−type gene β mbA2 76 100 100 zfbB2 βB mbB2 zfbB3 100 100 mbB3 β−type gene 0.1 22 79 cN-crystallin ... sequenced from a cDNA library made from western grey kangaroo 22 77 cN-crystallin 22 78 G Wistow et al FEBS Journal 27 2 (20 05) 22 76 22 91 ª 20 05 FEBS G Wistow et al cN-crystallin Fig Protein sequences ... human FEBS Journal 27 2 (20 05) 22 76 22 91 ª 20 05 FEBS G Wistow et al 38 39 40 41 42 43 44 45 46 47 48 49 50 beta B1 alters the elongated structure of the dimer Exp Eye Res 72, 27 9 28 8 Broide ML, Berland...

16
561
0

Tài liệu Báo cáo khoa học: Complete subunit sequences, structure and evolution of the 6 · 6-mer hemocyanin from the common house centipede, Scutigera coleoptrata pptx

Ngày tải lên : 20/02/2014, 11:20

... AJ344359 AJ5 127 93 AJ431379 AJ344360 AJ431378 AJ297738 22 58 22 83 22 36 22 71 22 09 20 82 656 659 673 668 685 653 74.44 73.93 75.91 74.75 77.74 73.74 5.44 5.57 5.68 6.18 5.79 6.16 0.66 0. 92 1.07 0.89 ... (GlaxoWellcome) [25 ] at the following address: http:// www.expasy.ch/spdbv/using the known arthropod hemocyanin crystal structures [26 ,27 ] as templates Ó FEBS 20 03 28 62 K Kusche et al (Eur J Biochem 27 0) ... diverged only some 22 0 million years ago [6,55], and assemble to quaternary structures that may even differ within species [22 ] Ó FEBS 20 03 28 66 K Kusche et al (Eur J Biochem 27 0) Although the...

9
552
0

Tài liệu Báo cáo Y học: Evolution of the enzymes of the citric acid cycle and the glyoxylate cycle of higher plants pdf

Ngày tải lên : 22/02/2014, 04:20

... eukaryotic chromosomes: a case Ó FEBS 20 02 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 study of functional redundancy in ancient pathways through endosymbiosis Curr Genet 32, 1±18 Martin, W (1999) Mosaic ... of genomes Bioessays 21 , 99±104 Doolittle, W.F (1999) Phylogenetic classi®cation and the universal tree Science 28 4, 21 24 21 28 Henze, K., Schnarrenberger, C & Martin, W (20 01) Endosymbiotic gene ... hydrogenosomes [21 ,22 ] and in Euglena mitochondria [39] The E2 subunit of PDH contains the dihydrolipoamide transferase activity The mitochondrial form of the E2 subunit for PDH is related to the E2 subunits...

16
474
0

THE EVOLUTION OF THE RUSSIAN SAVING BANK SECTOR DURING THE TRANSITION ERA docx

Ngày tải lên : 06/03/2014, 10:20

... 18 23 12 13 16 15 15 16 13 12 13 14 60 51 41 44 35 34 42 42 42 44 42 45 47 45 75 72 60 62 57 54 59 59 59 64 66 71 74 75 92. 8 92. 9 93.0 93.0 93.0 93.1 93.0 92. 8 92. 8 92. 7 92. 6 92. 5 92. 3 92. 3 9 2 ... −1 + α 21 K i + α 22 Li + α 31 Ai ,t−1 + α 32 INTi ,t −1 + ε it (8) Ait = β 10 + β 11S it + β 121 K i + β 122 Li + β13 Ai ,t −1 + η1it (9) INTit = β 20 + β 21 S it + β 22 1K i + β 22 2 Li + β 23 INTi,t ... 0.409 (15.0) β 21 0.954 (9.3) (9.7) (6.0) INT−1 R (27 ) 0.898 0. 829 0.958 0. 922 0.898 0.830 0.959 0. 923 R (28 ) 0 .28 0 0 .25 5 0.311 0 .24 6 0.559 0.419 0.639 0.568 R (29 ) 0.110 0.1 62 0. 129 0.156 0.390...

26
334
0

The Internet of Things - How the Next Evolution of the Internet Is Changing Everything doc

Ngày tải lên : 06/03/2014, 21:20

... Between 20 08 and 20 09 Source: Cisco IBSG, April 20 11 Looking to the future, Cisco IBSG predicts there will be 25 billion devices connected to the Internet by 20 15 and 50 billion by 20 20 It is ... Source: Wikipedia, 20 11 Source: Cisco IBSG, 20 11 Sources: U.S Census Bureau, 20 10; Forrester Research, 20 03 Source: Wikipedia, 20 10 Sources: Cisco IBSG, 20 10; U.S Census Bureau, 20 10 While no one ... Eye,” Christopher Trout, Endadget, February 26 , 20 11, http://www.engadget.com /20 11/ 02/ 26/researchers-debut-one-cubic-millimetercomputer-want-to-stick-i/ 12 Cisco’s Internet Routing in Space (IRIS)...

11
772
6

Báo cáo khoa học: Analysis of the NADH-dependent retinaldehyde reductase activity of amphioxus retinol dehydrogenase enzymes enhances our understanding of the evolution of the retinol dehydrogenase family pot

Ngày tải lên : 07/03/2014, 09:20

... with Rdh21)335-pEGFP-N2, Rdh21)58-pEGFPN2, Rdh21 )28 -pEGFP-N2, pEGFP-C2-RDH21)335 and pEGFP-C2-RDH 229 5)335 constructs (RDH21)335-GFP, RDH21)58-GFP, RDH21 )28 -GFP, GFP-RDH21)335 and GFP-RDH 229 5)335, ... Journal 27 4 (20 07) 3739–37 52 ª 20 07 The Authors Journal compilation ª 20 07 FEBS ´ D Dalfo et al 12 13 14 15 16 17 18 19 20 21 22 23 in the 9-cis retinoic acid biosynthetic pathway FEBS Lett 428 , ... Amphioxus retinol dehydrogenase enzymes RDH2 forms (RDH21 )22 9, RDH21)165, RDH21)137, and RDH21)58 RDH21 )28 ) fused either to b-galactosidase (Fig 2N–Q) or to GFP (Fig 2G,H), whereas the b-galactosidase...

14
477
0

Báo cáo khoa học: Subunit sequences of the 4 · 6-mer hemocyanin from the golden orb-web spider, Nephila inaurata Intramolecular evolution of the chelicerate hemocyanin subunits pot

Ngày tải lên : 08/03/2014, 08:20

... NinHc-f NinHc-g AJ547807 AJ547808 AJ547809 AJ547810 AJ547811 AJ5478 12 2067 20 60 23 27 21 06 21 52 2059 630 628 627 625 626 626 72. 09 72. 59 71.94 71.00 71.73 71.19 5.39 6.06 6.36 5.49 6.09 5.88 a Without ... hemocyanin subunits a–g (acc nos: X16893, AJ290 429 , AJ277489, AJ290430, X16894, AJ277491 and AJ2774 92) Ó FEBS 20 03 Spider hemocyanin (Eur J Biochem 27 0) 3437 Table Sequence comparison of N inaurata ... on the known sequence of subunit c of E californicum [19] (5¢ ﬁ 3¢: bp 22 0 23 9, 591–608, 925 –947, 3¢ ﬁ 5¢: 947– 925 , 128 6– 126 5, 1474–1453) and used them for various PCR experiments with the cDNA...

8
415
0

Báo cáo khoa học: Evolution of the teleostean zona pellucida gene inferred from the egg envelope protein genes of the Japanese eel, Anguilla japonica potx

Ngày tải lên : 15/03/2014, 23:20

... GANGXAD (22 0 22 6) RTDPNLVLLL (25 7 26 6) AHXGESSVQLEVD(1 72 184) TELHSXGSVL (22 0 22 9) VDMDLLGIGH(148–158) LQLQLDAFRF(353–3 62) AXSFPLG(389–395) RQPVAPVSR(39–47) FIHVPM(69–74) ALGSTPIIRTNGA (21 3 22 5) DSPVIRAIVTGQP( 52 64) ... 27 7 (20 10) 4674–4684 ª 20 10 The Authors Journal compilation ª 20 10 FEBS K Sano et al Egg envelope of Japanese eel eZPCa 173 eZPCb 139 eZPCc 138 eZPCd 486 eZPCe 170 23 2 198 197 545 22 7 eZPCa 23 3 ... EDSLIYTFSLNYQPKALVGTPIVRSSEAVVLIQCHYPRLHNVSSNALHPTWIPYQSAMSA EDTLVYTFTIRYQPKAIGVTPIIRTNDAAVGVQCHYMRLHNVSSNALKSTWIPYYSTLSA 29 2 25 8 25 7 605 28 7 eZPCa 29 3 eZPCb 25 9 eZPCc 25 8 eZPCd 606 eZPCe 28 8 EDLLVFSLRLMADNWQTERTSAVFFLGDLINIEASVVQANHVPLRVFVDTCIATLDPDMN...

11
436
0

The origin and evolution of the solar system woolfson

Ngày tải lên : 17/03/2014, 13:35

... magnetism 9.4.1 A dynamo theory 9.4 .2 The induction model of lunar magnetism 9.5 Summary 25 1 25 1 25 1 25 4 25 5 25 6 26 1 26 3 26 5 26 7 26 9 27 1 27 2 27 4 27 6 27 8 28 2 28 4 28 5 29 3 xii Contents 10 Smaller planets ... planetary orbits 7 .2 Initial planetary orbits 7 .2. 1 The Accretion and Solar Nebula Theories 7 .2. 2 The Proto-planet Theory 7 .2. 3 The Capture Theory 20 9 20 9 20 9 21 0 21 4 21 5 21 6 22 1 22 2 22 3 22 3 Contents ... 0.07 0.0 02 0.105 0.001 0. 029 0.104 0. 028 0.163 0 .25 0 14 .22 0.188 20 60 110 90 20 0 60 390 510 1060 30 25 1 120 30 1530 5150 28 0 1440 22 0 1 .2 1.1 1.0 1.4 1.3 1.9 1.9 1 .2 Figure 1.9 The Lagrange...

426
435
0

EVOLUTION OF THE MOLECULAR BIOLOGY OF BRAIN TUMORS AND THE THERAPEUTIC IMPLICATIONS pdf

Ngày tải lên : 23/03/2014, 10:20

... 20 03; 1 62: 19 27 [22 3] Wahl ML, Kenan DJ, Gonzalez-Gronow M, Pizzo SV Angiostatin’s molecular mech‐ anism: aspects of specificity and regulation elucidated J Cell Biochem 20 05;96 :24 2– 26 1 [22 4] ... Oncol 20 07 ;25 :4 722 – 4 729 [20 1] Norden AD, Young GS, Setayesh K, et al Bevacizumab for recurrent malignant glio‐ mas: efficacy, toxicity, and patterns of recurrence Neurology 20 08;70:779 –787 [20 2] ... human gliomas Cancer Biol Ther 20 06 Apr;5(4):441-8 [ 121 ] Demuth T, Berens ME Molecular mechanisms of glioma cell migration and invasion J Neurooncol 20 04; 70 :21 7 22 8 [ 122 ] Goodenough DA, Goliger JA,...

648
573
0

Báo cáo " EVOLUTION OF THE INDIAN NUCLEAR POWER PROGRAM " doc

Ngày tải lên : 24/03/2014, 01:21

... Operational 19 92 KAPS-1 PHWR 22 0 India Operational 1993 KAPS -2 PHWR 22 0 India Operational 1995 RAPS-3 PHWR 22 0 India Operational 20 00 RAPS-4 PHWR 22 0 India Operational 20 00 KGS-1 PHWR 22 0 India Operational ... October 20 05, and for TAPS-3 it is July 20 06 (11) 3 Oct 20 02 10:8 3 82 AR AR171-EG27- 12. tex AR171-EG27- 12. sgm LaTeX2e (20 02/ 01/18) P1: GJC GOPALAKRISHNAN Advanced Heavy Water Reactor In July 20 01 ... whereas by 20 02 the Indian PHWRs reached an average Oct 20 02 10:8 AR AR171-EG27- 12. tex AR171-EG27- 12. sgm LaTeX2e (20 02/ 01/18) P1: GJC INDIAN NUCLEAR POWER PROGRAM 389 annual PLF of 82. 6%, much...

29
319
0

Regulation and the Evolution of the Global Telecommunications Industry pot

Ngày tải lên : 24/03/2014, 02:20

... Numbers (ARIN) from 20 00 to 20 02, and on the Meetings and Conference Board of the Institute of Electrical and Electronics Engineers (IEEE) Communications Society from 20 01 to 20 05, and as Chair ... terms of BB infrastructure (see OECD, 20 09; CRTC, 20 09) Some specialists (Waverman 26 Regulation and the evolution of the global telecoms industry et al., 20 07) have started questioning the (theoretical) ... development of the theory of the ladder of investment (Cave and Vogelsang, 20 03; Cave, 20 06, 20 07; Bourreau and Dogan, 20 06) many researchers have investigated in some detail the conditions under...

369
548
1

The Evolution of the Subprime Mortgage Market pptx

Ngày tải lên : 29/03/2014, 01:20

... $94.3 62. 9% $1,450.0 10.3% 1999 $160.0 $105.6 66.0% $1,310.0 12. 2% 20 00 $138.0 $1 02. 2 74.1% $1,048.0 13 .2% 20 01 $173.3 $ 126 .8 73 .2% $2, 058.0 8.4% 20 02 $21 3.0 $187.6 88.1% $2, 680.0 7.9% 20 03 $3 32. 0 ... 1997 100.7% 45.9% 32. 1% 53.0% 1998 1 02. 3% 62. 2% 37.6% 55.1% 1999 88.1% 67.0% 30.1% 37.4% 20 00 89.5% 55.6% 18.0% 40.5% 20 01 1 02. 5% 71.5% 31.4% 54.7% 20 02 92. 6% 72. 8% 32. 0% 57.6% 20 03 94.9% 75.9% ... Dollars 25 0,000 FICO Յ 500 500 < FICO Յ 600 600 < FICO Յ 700 700 Յ FICO < 800 800 Յ FICO 20 0,000 150,000 100,000 50,000 1995 1996 1997 1998 1999 20 00 20 01 20 02 2003 20 04 20 01 20 02 2003 20 04 SOURCE:...

26
382
0

eccles - evolution of the brain - creation of the self (routledge, 1986)

Ngày tải lên : 03/04/2014, 12:06

... of human evolution 12 2.1 The hominid ancestry 12 2 .2 The Australopithecines 15 2. 3 Homo habilis 21 2. 4 Homo erectus 24 2. 5 The Neandertals 26 2. 6 Homo sapiens sapiens 28 2. 7 Problems of hominid ... person 22 7 10 The human person 22 8 10 Cultural evolution 22 9 10 Biological and cultural evolution 23 2 10 The concept of mind 23 6 10 Specific human characteristics 23 9 10 Evolution of human nature 24 6 ... selfconsciousness 21 1 9.5 The unity of the self 21 3 9.6 Commissurotomy 21 5 9.7 The evolutionary significance of the cerebral asymmetry 22 0 vii 9.8 Developmental and structural indications of neocortex 22 1 having...

310
488
0

woolfson m.m. origin and evolution of the solar system

Ngày tải lên : 24/04/2014, 17:26

... magnetism 9.4.1 A dynamo theory 9.4 .2 The induction model of lunar magnetism 9.5 Summary 25 1 25 1 25 1 25 4 25 5 25 6 26 1 26 3 26 5 26 7 26 9 27 1 27 2 27 4 27 6 27 8 28 2 28 4 28 5 29 3 xii Contents 10 Smaller planets ... planetary orbits 7 .2 Initial planetary orbits 7 .2. 1 The Accretion and Solar Nebula Theories 7 .2. 2 The Proto-planet Theory 7 .2. 3 The Capture Theory 20 9 20 9 20 9 21 0 21 4 21 5 21 6 22 1 22 2 22 3 22 3 Contents ... 0.07 0.0 02 0.105 0.001 0. 029 0.104 0. 028 0.163 0 .25 0 14 .22 0.188 20 60 110 90 20 0 60 390 510 1060 30 25 1 120 30 1530 5150 28 0 1440 22 0 1 .2 1.1 1.0 1.4 1.3 1.9 1.9 1 .2 Figure 1.9 The Lagrange...

425
4.6K
0

EVOLUTION OF THE EARTH MOON SYSTEM

Ngày tải lên : 28/04/2014, 20:58

... E E1  I M 1M  I M 2  L1 0.3 Final Separation and Angular Frequency of the Earth-Moon System 2a 2b 2c 2 D2 G M E 0 .2 D2  L1 GM E M M 0.5 2  G2 M E M M L1 0.5 2d The moment of inertia ... ri5 ( i  o )] 2e IE  4 [ro o  ri5 ( i  o )]  8.01037 kg m2 2f L1  I E E1  I M 1M  3.41034 kg m2 s-1 0.5 0 .2 0 .2 2g D2  5.4 108 m, that is D2 1.4 D1 0.3 2h 2 1.6106 s-1, ... days 0.3 2i Since I E 2 1.310 32 kg m2 s-1 and I M 2  3.41034 kg m2 s-1 , the approximation is justified since the final angular momentum of the Earth is 1 /26 0 of that of the Moon 0 .2 How much...

11
441
0

why think the evolution of the rational mind jun 2007

Ngày tải lên : 11/06/2014, 00:45

... references ISBN 978–0–19–518985–8 Knowledge, Theory of Evolution Reasoning I Title BD177.D413 20 07 128 ’.33—dc 22 2007009407 Printed in the United States of America on acid-free paper Preface Z It’s fashionable ... France as Evolution et Rationalite (20 04) Copyright ß 20 04 Presses Universitaires de France English translation copyright ß 20 06 by Ronald de Sousa Copyright ß 20 07 by Oxford University Press, Inc ... (Canguilhem [1966] 1994, 323 ) It is not surprising, therefore, that we should be tempted to attribute such complex and protean adaptations to a creative intelligence 29 30 Why Think? Z 2. 1 Cause and Teleology...

198
290
0