... co-immunoprecipitation approach in our search fornovel interacting proteins Using the former approach, the catalytic α subunit of protein kinase CK2 (formerly known as casein kinase 2) was isolated from rat ... reasonable since some potential substrates of CK2 are localized in the matrix of mitochondria (Meggio and Pinna, 2003) CK2 has been identified as an endoplasmic reticulum (ER)-associated kinase ... dual specificity (Ser/Thr and Tyr) class of kinases, depending on the residue being targeted for phosphorylation All known protein kinases of this class share a related catalytic domain and are...
... peptide After incubation, an assay for cell viability was carried out using Living Cell Count Reagent SF (Nacalai Tesque) according to the manufacturer’s protocol Absorbance was measured at a wavelength ... Human recombinant FKBP5 and PP5 were purchased from Abnova Anti-b-actin antibody and human recombinant Hsp70 were purchased from SIGMA All reagents were of reagent-grade quality Expression and ... (Antp-TPR-TAMRA) or TPR (TPR-TAMRA) as indicated Cells were then analyzed by phase-contrast (DIC), fluorescence (TAMRA-red) or merge image (DIC and TAMRA-red) All images were taken using confocal laser...
... a trained agent, the 50/50 arrangement doesn’t change as drastically as it can in the residential arena ߜ You construct your own database Commercial real estate is a database business For example, ... be available at the drop ofa hat largely because agents have trained them to expect service 24 hours a day, days a week The National Association of Realtors ran a huge marketing campaign a few ... residential agents actually build and run a business Asa successful residential agent you handle sales and marketing, leadership of people, vision casting, financial management, and all other aspects...
... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... using Thlaspi caerulescens asa model system Ann Bot 102, 3–13 Weber M, Harada E, Vess C, Roepenack-Lahaye E & Clemens S (2004) Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis ... in YNB medium at 30 °C, and imaged with a laser scanning confocal microscope (FV 1000; Olympus, Tokyo, Japan) Metal accumulation assay The Cd2+ accumulation assay was performed as described in...
... isolated and its physico-chemical properties characterized as described previously [19] All other chemicals were purchased from standard commercial sources as analytical grade reagents RNAP assays ... Thermus aquaticus core ˚ RNA polymerase at 3.3 A resolution Cell 98, 811–824 Murakami, K.S., Masuda, S & Darst, S .A (2002) Structural basis ˚ of transcription initiation: RNA polymerase holoenzyme at ... Selva, E (2004) Antibiotic GE23077, a new inhibitorof bacterial RNA polymerase I Taxonomy, isolation and characterization J Antibiot 57, 210–217 20 Plevani, P., Albertini, A. M., Galizzi, A. , Adamoli,...
... interpretation of data MR carried out the ELISA experiments and participated in analysis of data CA performed the statistical analysis and the clinical associations AS participated in the analysis and ... used as second antibodies and incubated (100 µl/well) for hour at 20°C o-Phenylenediamine dihydrochloride (Sigma) was used asa substrate and absorbance was measured at 490 nm Means + standard ... Psychiatric Association; 1994 14 Margutti P, Delunardo F, Sorice M, Valesini G, Alessandri C, Capoano R, Profumo E, Siracusano A, Salvati B, Rigano R, et al.: Screening ofa HUAEC cDNA library...
... (Trans-35S label; ICN Biochemicals, Costa Mesa, CA, USA) and RNasin® Ribonuclease Inhibitor (Stratagene) as recommended by the manufacturer (Promega) Translation was carried out at 30°C for 1.5 h ... antigen (AECA) has been reported Reports on the prevalence of AECA have varied largely and alpha-enolase was reported as one of the putative target antigens [26] In this study, the use of bovine aortic ... anti-kinectin and anti-PMS1 antibodies in Japanese aplastic anaemia patients Br J Haematol 2005, 128:221-223 39 Imai H, Nakano Y, Kiyosawa K, Tan EM: Increasing titers and changing specificities of antinuclear...
... RNA was extracted and analyzed at day of differentiation Mature miRNA expression was evaluated using Mirscript assays (Qiagen SA) as specified by the manufacturer’s protocol Real-time PCR was ... renilla and firefly luciferase activities were assayed with the Dual Glo Luciferase Assay System (Promega) and measured with a luminometer (Luminoskan Ascent, Thermo Scientific, Waltham, MA, USA) ... non-coding RNA (ncRNA) Reads that did not match any of those non-coding RNA classes were labeled as ‘non-annotated’ Data are the average of read sequencing frequency (percentage) for each experimental...
... at least analyzed for each donor However, the infiltration observed and vascular congestion was not general and was graded as "minimal" and edema could not be observed (Table 2) (Figures 5A and ... "unacceptable" Formulations with vaginal irritation ratings between and are considered acceptable for vaginal application [16] Statistical analysis Statistical significance of the treated group mean ... tracts were surgically excised and parts of the upper (cervicovagina), middle (midvagina), and lower (urovagina) areas of each vagina were fixed with formalin and paraffin embedded by standard...
... augment the detection process We are not alone in this vision, as others have also adopted this strategy asa way forward in molecular analysis Alagaratnam et al are utilising Bayesian approaches ... other arbitrary measures for disease classification Adopting a systems biology approach, whereby a disease defining molecular fingerprint is analysed, would increase the accuracy of disease diagnosis, ... 51(12):2333-2340 Okamoto M, Kawabe T, Iwasaki Y, Hara T, Hashimoto N, Imaizumi K, Hasegawa Y, Shimokata K: Evaluation of interferon-gamma, interferon-gamma-inducing cytokines, and interferongamma-inducible...
... proposed as an ATM inhibitoras it was found to be able to physical interacts with ATM at Ser 1981 that is auto phosphorylated and is essential for the response to DNA damage (Bakkenist and Kastan ... telomerase inhibitors They vary in form of screening targets as well as the screening approaches A summary of telomerase targeted cancer therapy and screening that has being published is available ... Telomerase related screen Wnt signaling pathway Canonical Wnt pathway Non-canonical Wnt pathway Material and Methods Material Cell line Inhibitor library Plasmid List of primers List of antibodies...
... dose of the aptamer, hence an antidote was created that consisted ofa short RNA complementary to a large section of the aptamer This antidote was able to neutralise more than 95% of the anticoagulation ... consideration asa field-ready rapid diagnostic kit for Malaria [McNamara et al, 2004] In this work, we were thus motivated to show a Proof -of- Concept in the application of e-SRS asa potentially rapid ... RTA results for NASBA RTA (with AS added after NASBA) using Mz based sensors for Mfs 196 Figure 4.5-5 RTA results for sNTS RTA (with some AS added in RTA) using Mz based sensors for...
... GAATTCCTCGAACCGTCCATCGTC 60.0 KHWTTSS2P2 GGATCCGATCGTGTCGAACGAGATCA 60.0 KHWTTSS2P3 GGATCCGGCATCGACGGTATTCT 66.9 KHWTTSS2P4 AAGCTTATATCGCCGGGATAGCGTA 66.9 BTTTSS2P1 aaGAATTCGGTGGCCTCCAGAAACAGT ... (5’-3’) Annealing Temperature (oC) 60.7 KHWTTSS1P1 GAATTCCGAACCGCTTTGTGATAACC KHWTTSS1P2 GGATCCGATCTTGAGCAGATGCTTG 60.7 KHWTTSS1P3 GGATCCGCCACGATATCCTCGAAAAG 60.7 KHWTTSS1P4 CTGCAGAGCTACGCCGTGAACGTATT ... responsible for 20% of all community acquired septicaemias and 40% of sepsis related mortality in northeast Thailand (White, 2003) It is classified asa risk group agentas well asa potential bioterrorism...
... Statistical data analysis SAS for Windows Version 9.2 (SAS Institute, Cary, NC, USA) was used for all analyses Data are presented as means and standard deviations (mean ± SD) or medians and interquartile ... AAA CAG ATG CTA ATA CCG 21 nt Lacto-R2 CGT CCA TTG TGG TAG ATT CCC T 22 nt Lacto-S CTG AGA CAC GGC CCA WAC TCC TAC GG 26 nt F_reut_IS ACC GAG AAC AAC GCG TTA TTT 21 nt R_reut_IS CAT AAC TTA ACC ... package was handed to the particular participant Statistical data analysis and power calculation Statistical data analysis and the power calculation were performed in cooperation with Dr Klaus...
... Further information about ValEncIA-IVP as well as free software are available at http://www.valencia-ivp.com 3 assumed to be given in state space representation p (t) = ∆p (t), where both p (t) and ... ESEARCH In this paper, VAL E NC IA-IVP has been introduced asanovel approach for validation of state enclosures for initial value problems with both uncertain initial conditions and tolerances ... differently For VAL E NC IA-IVP, a MATLAB implementation using INTLAB 5.2 [19], [20] as well asa prototypical C++ implementation using PROFIL/ BIAS [21] and FADBAD [22] are compared Reducing...
... have a great tendency to attract the attention of students that other forms of the mass media lack According to Subramaniyan A Nambiar (1985), “ Even the person who is totally tone deaf may at ... The time for the test was within fifteen minutes During the test, the teacher worked asa cassette player and examiner The marking was done with the same way of assessment and then was analyzed ... class A However, the comparison of the modes reveal that the class B seems to be better than class Aas its modes of six is higher than the one of class A which is five -Correlation: N Class A...
... case study asa form of data collection and even asa type of unstructured analysis: Asa form of research, the case study is unparalleled for its ability to consider a single or complex research ... are especially adamant that a case database be created and maintained to \allow repetition and re-evaluation of cases Reliability is most important during the data collection phase, and involves ... process of preparation, and has summarized major criticisms An epistemological base for analyzing the value of case study research programmes has been ruled out asa major threat because of inconsistencies...
... UUAGGACAUAUAGUUAGCCCUAGG unknown UGGGU CUAGACUAGA CCAGUAGAUCCUAGACUAGA GAAGAAGCGGAGACAGCGACGAAGA AGAUCCAUUCGAUUAG unknown UAGUGAAUAGAGUUAGGCAGGGA GAAGAAGAA UAGAAGAAGAA 4995–5017 [5, 12, 38, 40] 5362–5366 ... cells Proc Natl Acad Sci USA 91, 7311–7315 32 Kamata M, Nitahara-Kasahara Y, Miyamoto Y, Yoneda Y & Aida Y (2005) Importin-alpha promotes passage through the nuclear pore complex of human immunodeficiency ... coactivators J Virol 76, 9724–9734 HIV-1 alternative splicing regulation 34 Kuramitsu M, Hashizume C, Yamamoto N, Azuma A, Kamata M, Yamamoto N, Tanaka Y & Aida Y (2005) Anovel role for Vpr of...