Characterization and function of two g protein regulators, vertebrate LGN and drosophila RapGAP

... Fig 4.4 Binding of zebrafish LGN/ AGS3 to G i/o 117 Fig 4.5 GDI activity of LGN/ AGS3 from zebrafish 118 Fig 4.6 Downregulation of LGN in zebrafish embryo by morpholino 120 Fig 4.7 Effects of LGN ... characterizing two GoLoco motif-containing regulators of G- protein signaling, vertebrate LGN and Drosophila RapGAP using mammalian cell culture systems, zebrafish...

Ngày tải lên: 12/09/2015, 09:42

... process of soybean seeds as decreases in the mRNA levels of GmPDIL-1, GmPDIS-1 [26] and GmPDIM [27] were observed during the accumulation of the storage proteins Expression of certain seed storage proteins ... (2008) A novel plant protein disulfide isomerase family homologous to animal P5: molecular cloning and characterization as a functional protein f...

Ngày tải lên: 07/03/2014, 05:20

... be involved in the induction of apoptosis, including the 7a and 7b proteins [18,46,47] To analyze whether the deletion in ORF 7b had any influence on its Amino acid variability in ORF 7b and ... overexpression of ORF 7a, ORF interferon induction the Influence on apoptosis and type I 7b, and ORF 7b with by Influence on apoptosis and type I interferon indu...

Ngày tải lên: 12/08/2014, 04:20

... apoptosis, including the 7a and 7b proteins [18,46,47] To analyze whether the deletion in ORF 7b had any influence on its Amino acid variability in ORF 7b and RT-PCR analysis of ORF 7b in clinical ... sequences in GenBank (except in an independent sequence of the Frankfurt strain) , and in none of SARSlike bat-CoV sequenced in the ORF 7b region...

Ngày tải lên: 12/08/2014, 04:20

... 5¢-CAGAATTCatg gagcagaagctgatctccgaggaggacctgctgGTGAACAACTCCAC CAACTCCTCCAACAACTCCCTGGCTCTTACAAGTC CTTATAAGACA-3¢; HsM2-as, 5¢-TTACCTTGTAGCG CCTATGTTCTTATAATG-3¢ (An engineered EcoRI recognition ... the coupling of M2 with GOA-1 We prepared an M2 mutant: :GOA-1 fusion protein and directly assessed the muscarinic- ligand-dependent activation of GOA-1 Results Expressio...

Ngày tải lên: 07/03/2014, 11:20

... doi:10.1186/1465-9921-12 -39 Cite this article as: Nikota et al.: Differential expression and function of breast regression protein 39 (BRP -39) in murine models of subacute cigarette smoke exposure and allergic airway ... the induction of BRP39 In contrast, BRP -39 was required for the expression of allergic airway inflammation Our study...

Ngày tải lên: 12/08/2014, 13:22

... Systematic mapping of two component response regulators to gene targets in a model sulfate reducing bacterium Lara Rajeev, Eric G Luning, Paramvir S Dehal, Morgan N Price, Adam P Arkin and Aindrila ... enriched as targets in our assay (Table S9 in Additional File 1) Interestingly many of these are flagella and motility related genes, suggesting that they ar...

Ngày tải lên: 09/08/2014, 23:20

... Italy) with full-length mm bore ETT (Portex, Hythe, UK) Operating the TC function involves specifying the size and type of the tubes and then selecting the degree of TC Compensation settings vary ... ventilator On comparing these two ventilators, the DT did not vary significantly Discussion There are two major findings of the present study First, with both the DE4 a...

Ngày tải lên: 12/08/2014, 19:22

... RGS are modulated by lipopeptides and LPS S Riekenberg et al to the number and length of their fatty acids and the amino acid sequence of their peptide tail To address TLR2 ⁄ 1- and TLR2 ... modulation of RGS1 and RGS2 in BMDM after stimulation with LP and LPS in more detail, because regulation of RGS1 and RGS2 after activation of different TLR may modify the e...

Ngày tải lên: 18/02/2014, 13:20

... Function and pharmacology of hetero-oligomers Effect of hetero-oligomerization on G-protein coupling and function To make the issue even more complicated, hetero-oligomerization has been ... molecules of b-arrestin and then the activation of ERK (B) Only one molecule of b-arrestin binds to the ligand-saturated receptor dimer and activates ERK (C) A dimer...

Ngày tải lên: 16/03/2014, 22:20

... Abbreviations and Symbols Used ABCG ATP-binding cassette protein G gene subfamily ACAT acyl-CoA: cholesterol acyltransferase ALP alkaline phosphatase AMPK AMP-activated protein kinase APOE4 apolipoprotein ... 35 - associates with ER membranes by interacting with VAMP associated protein (VAP, VAP -A and VAP-B) (Wyles et al., 2002) Both VAP -A and VAP-B (INSIG1 and 2) associate...

Ngày tải lên: 12/09/2015, 09:42

... ANALYSIS OF REGULATOR OF G- PROTEIN SIGNALING (RGS) FUNCTION IN GROWTH, DEVELOPMENT AND PATHOGENICITY OF MAGNAPORTHE GRISEA HAO LIU A THESIS SUBMITTED FOR THE DEGREE OF DOCTOR OF PHILOSOPHY ... yeast…………………………………………… 22 1. 2.2.3 G proteins in mammals………………………………………… 23 1. 2.3 Desensitization of G protein Signaling ………………………… …… 24 1. 2.3 .1...

Ngày tải lên: 14/09/2015, 09:13

... HPH1 RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 ... FlbA Sst2 467 27 2 479 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA QQDRAYTAQYPGSQLFQPTKHSIYQITPNGKDLINGMNSRGRTSDAESTPRDHKPNEKLP QEDKGYPQPDASIVVFQPSKYAIYGITERGQRVCG -W...

Ngày tải lên: 14/09/2015, 09:24

... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 ... mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 MG01 031 5 MG010105 MG09 134 Control: Gamma actin MG 039 82 MG011 73 MG01 630 Figure 37 A B

Ngày tải lên: 14/09/2015, 09:39

... Figure 39 WT rgs1D Figure 40 Figure 41 Figure 42 _ Figure 43 - Gd + Gd, 1h + Gd, 0h + Gd, 2h + Gd, 0.5h + Gd, 3h _ Figure 44 A WT rgs1D Solvent Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D ... Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87...

Ngày tải lên: 14/09/2015, 09:53