use the id command both without and then with the a option
Báo cáo khoa học: An ‘Old World’ scorpion b-toxin that recognizes both insect and mammalian sodium channels A possible link towards diversification of b-toxins ppt
... quinquestriatus hebraeus was collected from scorpion stings to a parafilm membrane Sarcophaga falculata (blowfly) larvae and Periplaneta americana (cockroaches) were bred in the laboratory Albino laboratory ... compete with a- (Aah2) and b- (Css2) anti-mammalian toxins for binding to rat brain synaptosomes [23] As AahIT4 shares little sequence similarity with any of the known anti-mammalian scorpion ... purchased from the Levenstein farm in Yokneam, Israel As purified Lqhb1 was obtained in a limited amount, the toxin was also purchased from Latoxan (LTx-003; Valance, France) together with the anti-mammalian...
- 8
- 391
- 0
Báo cáo y học: " A case of spotted fever group rickettsiosis imported into the United Kingdom and treated with ciprofloxacin: a case repor" pptx
... after days of therapy with doxycycline As clinical symptoms were actually more intense on the 3rd day of therapy, therapy was changed to ciprofloxacin, and a rapid response was then observed ... the fatality rate can be up to 4% for Mediterranean Spotted Fever, no fatal case of African tick bite fever has been described Although there is no randomised clinical control trial data to guide ... probable As is the case with most common rickettsioses, African tick bite fever usually manifests with acute non-specific flulike symptoms which include fever, nausea, myalgias and headache The...
- 3
- 347
- 0
which are common used in intermediate – level english learners. and then, thesis concludes a range of verb – adverb collocations
... on the base According to Hausmann and Benson, the ‘base’ and ‘collocator’ relationship can be shown as follows: a Adverb + Adjective (collocator – base) Collocation formed by an adverb and an adjective ... describe a serious damage we use these adverbs The building was badly damaged by fire b slightly there is a damage but a small and not serious c irreparably, permanently She may have damaged her health ... language interference In Vietnamese, we also have collocation! For example, Vietnamese say: rua tay, rua mat, giat quan ao…but in native English speaker say: wash hand, wash clothes, but clean the...
- 52
- 330
- 0
Chinas foreign economic policy making and cooperation with ASEAN a case study of the ASEAN china free trade agreement
... viii Abbreviations ACFTA ASEAN-China Free Trade Agreement AFTA ASEAN Free Trade Area AMF Asian Monetary Fund APT ASEAN Plus Three ASEAN Association of Southeast Asian Nations APEC Asia Pacific ... China and Japan And a major impediment to the realization of an East Asia FTA is the competition between China and Japan for regional leadership Although Japanese officials stressed that Japan was ... of the availability of data and because of the timing when ACFTA was signed, the year 2002 is used in this study as the latest year for analyzing China’s policy decision on ACFTA and China-ASEAN...
- 165
- 597
- 0
Make expressive designs easily and quickly with just a line
... tracing Many images can be traced with the pen Use a dingbat Not handy with the pen tool? tool; all you need is a clear outline, which you’ll find in stand-alone objects (above) or as part of larger ... CARD Make expressive designs easily and quickly with just a line Design Line T There you are, shopping again at Banana Republic, when beside the cash register this credit-card application catches ... borders and so on—would weaken it What’s nice for the designer is that this technique is so easy Have a look 0621 One-line design MAPLE WOODS NATURAL AREA HAIRST YLES Diana’s Use a dingbat Not handy...
- 15
- 282
- 0
(1) how learners approach learning, both in and out of classrooms, and (2) the kinds of strategies and cognitive processing they use in second language acquisition
... 2: Learning strategies taught in the cognitive academic language learning approach (CALLA) Metacognitive strategies Advance organization Previewing the main ideas and concepts of the material to ... (metacognitive strategy) That was understandable as they were quite dynamic and they had a clear goal for their learning Their motivation for learning in general and learning English in particular ... qualitative and quantitative approach The present chapter offers detailed description of the research approaches, the participants, the specific methods of data collection, data analysis, as well as the...
- 83
- 622
- 0
Refusals to invitations the use of vietnamese learners of english and the use of native speakers of english a comparison
... subjects refused a bit less than the others The Turkish and American subjects used pause fillers and then statements of gratitude and appreciation, while the Laotian respondents used more statements ... frequency, the order and the content of semantic formulas The fact that the advanced learners of the study lack pragmatic competence has raised a matter for language teaching The learners’ pragmatic ... Japanese ESL learners’ refusals, Yamagashira (2001) compared the language patterns used to make refusals by both Japanese learners of English and American English NSs in different situations Additionally,...
- 44
- 1,183
- 4
Tài liệu Báo cáo khoa học: Gene transcription of fgl2 in endothelial cells is controlled by Ets-1 and Oct-1 and requires the presence of both Sp1 and Sp3 pdf
... AGG AG GTG GCG TCT GAG GTA CCA ATG CAA ATG CGC GCG CAT TTG CAT TGG TAC CTC AGA CGC CAC GAG ACT GTG ATG CGG TAC CTC CCG CCC TTT C GAA AAG GGC GGG AGG TAC CGC ATC ACA GTC TC GCA AAT GCG CCA GGT ACC ... CGAATGCAAATCACTAGAA-3¢; Sp1, 5¢-ATTCGATC GGGGCGGGGCGAGC-3¢; Ets/Pea3, 5¢-GATCTCGAG CAGGAAGTTCGA-3¢; Ets (PU.1), 5¢-GGGCTGCTTG AGGAAGTATAAGAAT-3¢; Stat3, 5¢-GATCCTTCTG GGAATTCCTAGATC-3¢; and C/EBP, ... TGG GAA CTC GAG TTC CCA GAA GGT ACC TGG CGC ATT TGC CCG CCC TTT TGA GGT ACC AGA GAA CGC CTG CAG GCG TTC TCT GGT ACC TCA AAA GGG CGG CTG GGA ACT CAT GGT ACC ACA GTC AGG CGG CCG CCT GAC TGT GGT ACC...
- 13
- 525
- 0
Tài liệu Smart Posters - How to use NFC tags and readers to create interactive experiences that benefit both consumers and businesses docx
... for a prepaid card application by waving a phone in front of the touchpoint The phone then communicated with the server over the air and downloaded a personalized VISA Prepaid Card This innovative ... paints and inks These materials could be included in the tag, tag package, the form factor of the poster, and even any adhesives that are used This is important because interference can degrade ... stand up to such use Because it is impossible to anticipate all variations of tags and readers, we recommend asking your tag supplier for guidance about optimal tag size and form factor Each tag...
- 25
- 591
- 0
Tài liệu Báo cáo khoa học: "Exploring the Use of Linguistic Features in Domain and Genre Classification" potx
... standardised frequency, rounded to the next integer value In the CL experiments, the lemma tag covers both real lemmata and punctuation marks, in LPE, punctuation marks had a separate precidate ... genres, "small" representative corpora such as LIMAS will in the end provide too little training material, because the emphasis is on capturing the extent of potential variation in a language, and less ... and Natural Language Workshop, pages 212217 Morgan Kaufman C Martindale and D MacKenzie 1995 On the utility of content analysis in author attribution: The Federalist Computers and the Humanities,...
- 8
- 689
- 1
Designed for Use: Create Usable Interfaces for Applications and the Web potx
... letters or in all capitals The Pragmatic Starter Kit, The Pragmatic Programmer, Pragmatic Programming, Pragmatic Bookshelf and the linking g device are trademarks of The Pragmatic Programmers, LLC ... we use animation most effectively? What are modes? What can we learn from video games? You can identify idea chapters by the light bulb on the first page The ideas in these chapters may not always ... claimed as trademarks Where those designations appear in this book, and The Pragmatic Programmers, LLC was aware of a trademark claim, the designations have been printed in initial capital letters...
- 315
- 1,320
- 0
Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot
... PHMDATVVSRILDEAGEIVAKTTCEDLCFSGGSHTSYPWPVLNPRNPEYMAGGSSSGSAV 177 PSEDATVVKRLLAAGATVVGKSVCEDLCFSGASFTSASGAVKNPWDLARNAGGSSSGSAV 177 PSEDATVVKRLLAAGATVIGKSVCEDLCFSGASFTSATGAVKNPWDLTRNAGGSSSGSAV 177 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA ... intermediates, and tetrahedral ( 109.5°) water-bonded intermediate In contrast, serine and thiol protease and amidase are confined to interacting with planar substrates and tetrahedral intermediates ... sonicated for at maximum amplitude and 300 lL of cell crude extract were assayed in standard conditions SsAH-WT and SsAH-K96R were used at 60 lgÆmL)1 and the acid produced was quantified by the amount...
- 9
- 478
- 0
Báo cáo Y học: The plant S-adenosyl-L-methionine:Mg-protoporphyrin IX methyltransferase is located in both envelope and thylakoid chloroplast membranes pot
... 4646±4651 Nakayama, M., Masuda, T., Bando, T., Yamagata, H., Ohta, H & Takamiya, K (1998) Cloning and expression of the soybean chlH gene encoding a subunit of Mg-chelatase and localization of the Mg2+ ... envelope and thylakoids fractions The fractions were analyzed by SDS/PAGE and Coomassie blue staining and MgPIXMT activity was compared to MGDG synthase activity as a marker of envelope membranes and ... predicted that the Arabidopsis protein presents a chloroplast transit peptide with a peptidase cleavage site located between amino acids 39 and 40 leading to a putative mature protein of 29 500 Da Indeed,...
- 9
- 568
- 0
e-Health and the Elderly: How Seniors Use the Internet for Health Information pot
... Medicare, the program that provides health insurance to people age 65 and older Medicaid (Medi-Cal, Mass Health, Carolina Access or Health Check, Health Choices, Tenn Care, Star Plus), the program ... year- olds and 2% o f s e n i o r s say they have ever communicated with a d o c to r o r other provider via e -mail O n the other hand, drug companies and o t h e r s a re using the Net to market ... e-health _and the elderly O ver the past ten years, the Internet has eme rg e d as an integral par t of the lives of many Amer i c a n s, transforming the way in which they get infor m at i o n a...
- 44
- 512
- 0
The a and b adapters are used as priming sites for both amplification
... ligase • The strands are denatured using sodium hydroxide to release the ssDNA template library (sstDNA) The Adapters • The A and B adapters are used as priming sites for both amplification and sequencing ... Preparation of the DNA • DNA is fragmented by nebulization • The DNA strand’s ends are made blunt with appropriate enzymes • A and “B” adapters are ligated to the blunt ends using DNA ligase ... filters all DNA rich beads from empty beads, and then extracts the biotin beads from the DNA rich beads • The DNA in the beads are denatured again using sodium hydroxide, creating ssDNA rich beads...
- 19
- 390
- 0
Báo cáo khoa học: Sulfated polysaccharides inhibit the catabolism and loss of both large and small proteoglycans in explant cultures of tendon doc
... it appears that the catabolism may involve the action of other matrix proteinases as well as that of aggrecanase [10] It has been demonstrated that CaPPS and heparin inhibit soluble aggrecanase ... pentosan polysulfate, a sulfated polyxylan that has been shown to modify both the symptoms and the progression of osteoarthritis in both humans and animals [21] We and others have shown that the calcium ... proteinases namely ADAMTS-1, -4 and -5 [12–17] In contrast, the degradation of small proteoglycans in cartilage, ligament and tendon appears to occur at a slower rate, even in the presence of catabolic...
- 10
- 414
- 0
Báo cáo khoa học: The duality of LysU, a catalyst for both Ap4A and Ap3A formation pdf
... LysU-catalysed Ap 4A and Ap 3A synthesis Both synthetic mechanisms are catalysed in the presence of Mg2+, Zn2+ and inorganic pyrophosphatase The pathways share a common step in the formation of a lysyl-adenylate ... trace contaminants in the Ap 4A stock, but no ADP or Ap 3A is produced (B) A catalysis mixture containing mM Ap 4A and mM ADP shows rapid loss of ADP and Ap 4A (fitting exponential decay curves), and ... when a mixture of ADP and Ap 4A : (m ⁄ m) was incubated with LysU in an identical catalysis mixture (minus inorganic phosphate or any other nucleotide), then Ap 3A was generated rapidly with an estimated...
- 11
- 527
- 0
the public domain, how to find and use copyright-free writings music art and more 5th (2010)
... Juliet); the animated films Snow White, Pinocchio, Beauty and the Beast, and The Little Mermaid; and a recent spate of films based on the works of Shakespeare and Jane Austen If the original works had ... Trademark laws: Brand names such as Nike and Avis, as well as logos, slogans, and other devices that identify and distinguish products and services are protected under federal and state trademark laws ... contact an attorney knowledgeable in copyright law if: • you believe the claim is not valid and don’t want to agree to the other side’s demands, or • the materials involved are highly valuable and...
- 484
- 825
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008