r 24 high throughput gas liquid and liquid liquid dynamic sequential screening reactor
CHEMICAL REACTIONS IN GAS, LIQUID AND SOLID PHASES: SYNTHESIS, PROPERTIES AND APPLICATION pptx
... where the most part of chapters were prepared by scientists from Russian Research Centers and from Research Centers of former Republics (now independent states) of the USSR It is now the right ... spin probe method [18, 19] on Bruker EMX ESR-spectrometer and was described by structural parameters at constant temperature of 293 K – order parameter (S) which means rigidity of surface areas ... nitro, nitrite, nitrate, carbonyl and hydroxy groups are formed in these polymers The following reaction mechanism at high temperatures was proposed: RH + NO2 → R + HNO2 (I.5) R + NO2 → RNO2...
- 294
- 641
- 1
Báo cáo khoa học: 15 N-Labelled proteins by cell-free protein synthesis Strategies for high-throughput NMR studies of proteins and protein–ligand complexes doc
... principle, this problem can be overcome by the use of auxotrophic E coli strains [13], but this requires protein preparations from different strains Cell-free protein synthesis systems are far ... straightforward combinatorial [15N]labelling scheme carries particular promise for accelerated studies of proteins by NMR spectroscopy by assigning residue type information to every amide cross-peak ... spectrum demonstrates that the w–v complex binds to c It was recorded at pH 6.9 and 25 °C on a 800 MHz NMR spectrometer (Bruker, Karlsruhe, Germany) [11] spectra of the reaction mixtures, which are...
- 6
- 461
- 0
Báo cáo khoa học: High-throughput two-hybrid analysis The promise and the peril pptx
... High- throughput two-hybrid analysis domain can activate transcription on their own, plasmid rearrangements or copy number changes that generate such auto-activators, or alterations at a reporter ... separate proteins that interact, and the order of genes encoding interacting proteins A striking insight to emerge from analyzing the overall protein networks that result from large-scale approaches ... increased likeliness [24] Several studies demonstrated that Saccharomyces cerevisiae genes whose encoded proteins interacted are more likely than random gene pairs to be transcriptionally CO–regulated...
- 9
- 317
- 0
DIRECT NUMERICAL SIMULATIONS OF GAS–LIQUID MULTIPHASE FLOWS pot
... are found in a large number of industrial applications For example, they carry vapor away from hot surfaces in boiling heat transfer, disperse gases and provide stirring in various chemical processing ... Cambridge University Press has no responsibility for the persistence or accuracy of URLs for external or third-party internet websites referred to in this publication, and does not guarantee that any ... efforts of many colleagues and friends First and foremost we thank our students, postdoctoral researchers and visitors for the many and significant contributions they have made to the work presented...
- 337
- 660
- 2
high throughput screening, methods and protocols
... Other enzymes Protein-protein Reporter gene Reporter gene Reporter gene FP, TRET, SPA Nuclear hormone receptor FLIPR, reporter gene, melanophores FLIPR, VIPR SPA, FP, FIDA GPCRs Cell-based Ion ... High Throughput Screening Assays 1 Design and Implementation of High Throughput Screening Assays Ricardo Macarrón and Robert P Hertzberg Introduction In most pharmaceutical and biotechnology ... instrument for accurate, high throughput optical screening J Biomol Screen 1, 75 – Hertzberg, R P., and Pope, A J (2000) High throughput screening: new technology for the 21st century Curr Opin...
- 240
- 348
- 0
macromolecular crystallography conventional and high throughput methods
... Biochimie Structurale, Institut Pasteur, URA 2185 du CNRS, 25 rue du Dr Roux, 75015 Paris, France delarue@pasteur.fr B Francois, IBMC-CNRS-ULP, UPR9002, 15 rue René Descartes, 67084 Strasbourg, France ... B.Masquida@ibmc.u-strasbg.fr ix x C O N T R I B U TO R S R J Morris, John Innes Centre, Norwich Research Park, Colney, Norwich NR4 7UH, UK Richard.Morris@bbsrc.ac.uk H M K Murthy, Center for Biophysical ... M., Court, S., Parmar, V., Bradley, C., and Ross, C K (1991) Rapid purification and characterisation of HIV-1 reverse transcriptase and RNase H engineered to incorporate a C-terminal tripeptide...
- 292
- 1,176
- 1
Báo cáo y học: "ISsaga is an ensemble of web-based methods for high throughput identification and semiautomatic annotation of insertion sequences in prokaryotic genomes" pdf
... ICDAQSVKVGNPRCHSIGFDGGKMVKGRKRHVLVDTLGLVLMVMVTAANISDQRGAKI LFWKARRQGASLSRLVRIWADAGYQGQALMKWVMDRFQYVLEVVKRSDNLAGFQVVSK RWIVERTFGWLLWSRRLNKDYEVLTRTAEALAYVAMIRLMVRRLAQEH" repeat_region Gene CDS repeat_region ... /translation="MPTAYDSDLTTLQWELLEPLIPAAKPGGRPRTTDMLSVLNAIFY LVVTGCQWRQLPHDFPCWSTVYSYFRRWRDDGTWVHINEHLRMQERVSEDRHPSPSAA ICDAQSVKVGNPRCHSIGFDGGKMVKGRKRHVLVDTLGLVLMVMVTAANISDQRGAKI LFWKARRQGASLSRLVRIWADAGYQGQALMKWVMDRFQYVLEVVKRSDNLAGFQVVSK ... ISfinder, the prokaryote IS reference centre database [7] and IS repository, which includes more than 3,500 expertly annotated individual ISs from bacteria and archaea and also provides a basis for...
- 9
- 672
- 0
Báo cáo y học: "High-throughput RNA interference screening using pooled shRNA libraries and next generation sequencing" ppsx
... (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited High- throughput RNA interference screening ... but miRNAs are processed into shorter RNA species containing a hairpin structure, known as shorthairpin RNAs (shRNAs) shRNAs are in turn processed into short double-stranded -2- pieces of RNA known ... screens, microarray hybridization is frequently used as a readout [1, 2] This approach requires the production of custom microarray chips for each library, has a limited dynamic range and is restricted...
- 41
- 439
- 0
báo cáo khoa học: " High-throughput SNP genotyping in the highly heterozygous genome of Eucalyptus: assay success, polymorphism and transferability across species" ppsx
... humans [33] and rarely reported for non-model plant genomes Recently however, a global genotyping error rate of 0.54% in 188 SNPs was reported for Pinus pinaster [10] and between zero and 1% in ... 456(7223):720-723 18 Novaes E, Drost DR, Farmerie WG, Pappas GJ Jr, Grattapaglia D, Sederoff RR, Kirst M: High- throughput gene and SNP discovery in Eucalyptus grandis, an uncharacterized genome BMC Genomics ... necessary to increase resolution and speed for a variety of applications A DArT array delivering around 3,000 to 5,000 dominant markers for mapping and population analyses was recently reported...
- 18
- 345
- 0
báo cáo khoa học: " High-throughput analysis of chromosome translocations and other genome rearrangements in epithelial cancers" pdf
... sequencing reads are generated, the reads used are longer, and bioinformatic analysis is refined Rearrangements in breast cancers are more numerous than expected There were many more structural variants ... occurred by removing or reshuffling exons that encode a repressive protein domain Well-characterized tumor suppressor genes such as the retinoblastoma gene RB also had internal rearrangements and ... [5] For cell lines, the median number of rearrangements per sample was 101 and ranged from 58 to 245 For the tumors, the median was 38 and ranged from to 231 Approximately 85% were intrachromosomal...
- 4
- 213
- 0
Báo cáo y học: "Establishment of a novel CCR5 and CXCR4 expressing line which is highly sensitive to HIV and suitable for high-throughput evaluation of CCR5 and CXCR4 antagonists" pdf
... Retrovirology 2004, rheumatoid arthritis [7,8]., allergic airway disease [9], and cancer [10-12] Important ligands for CCR5 are the βchemokines 'regulated on activation normal T cell expressed ... natural CCR5 and CXCR4 ligands and peptides derived thereof are capable to block the entry of R5 and X4 HIV-1 viruses respectively, small-molecule CCR5 and CXCR4 antagonists would be most attractive ... not by R5 strains CCR5- or CXCR4-transfected U87.CD4 cells are also widely used, and are even Page of 13 (page number not for citation purposes) Retrovirology 2004, http://www.retrovirology.com/content/1/1/2...
- 13
- 395
- 0
Multi target selection and high throughput quantitative structure activity relationship model development
... with noradrenaline transporter, H3 receptor, 5-HT1a receptor, 5-HT1b receptor, 5-HT2c receptor, Melanocortin receptor and Neurokinin receptor respectively The percentage value behind each target-pair ... 33.9% VEGFR-Lck: 27.9% Src-Lck: 57.1% VEGFR-Lck: 29.5% EGFR-Src: 25.9% R1 R1 R2 R1 O S R3 N N S R3 N N R2 O R2 R3 Scaffold D Scaffold C EGFR-FGFR: 32.4% EGFR-Src: 4.5% Src-Lck: 1.8% EGFR-PDGFR: 1.7% ... anticancer kinase targets, EGFR-VEGFR, EGFR-PDGFR, EGFR-FGFR and EGFR-Src The results show our consensus SVR QSAR models yield equivalent predictive accuracy for newly discovered chemicals and improved...
- 142
- 405
- 0
System level modeling of endothelial permeability pathway and high throughput data analysis for disease biomarker selection
... phylogenetics trees to reflect higher-order relationship between genes with similar expression patterns by either merging smaller clusters into larger ones, or by splitting larger clusters into smaller ones ... 2.3, Processing for microarray data and copy number variation were described Section, 2.4 2.5 present the method and strategies used for marker selection from microarray data 2.1 Methods for mathematics ... SNP microarrays have so many 22 Chapter Introdcution probes Third, since SNP microarrays are fundamentally similar to CGH microarrays, existing copy number analysis methods for CGH microarrays...
- 249
- 281
- 0
Development and application of a high throughput assay for discovery of starch hydrolase inhibitors
... FolinCiocalteu reagent according to literature [75] The compositions of cranberry pomace extracts, cranberry fruit extracts, and cinnamon bark extracts were analysed by high- performance liquid chromatography ... province of China Cranberry pomace and cranberry fruit powders were gifts from the Decas Farm (Wareham, MA) Cinnamon barks (Indonesia) were purchased in local market Plant extracts were prepared ... Phenylpropanoid sucrose esters (PSE) are naturally occurring compounds isolated from various plants, and are structurally characterized by a sucrose core where at least one –OH group is substituted for a phenylpropanoid...
- 225
- 290
- 0
Developing high throughput chemical approaches for proteomic profiling of aspartic proteases and protein kinases
... networks to molecular fingerprinting and ligand discovery Microarray technology was originally reported as peptide microarray by Fodor et al in 199157 and later adopted by Affymetrix and the Brown ... available: Saquinavir, Nelfinavir, Ritonavir, Lopinavir, Indinavir, Amprenavir, Fosamprenavir, Atazanavir, and Tipranavir Among them, Amprenavir, a hyrdroxyethylamine transition state analogure, is one ... [58 receptor tyrosine kinases (RTKs) and 32 nonreceptor tyrosine kinases (NRTKs)] Thus far, a large number of tyrosine kinases (both receptor and non-receptor types) are associated with cancer...
- 305
- 174
- 0
On interaction motif inference from biomolecular interactions riding the growth of the high throughput sequential and structural data
... primary, secondary, tertiary and quaternary structures of a protein are illustrated in Fig 2.7 Proteins are modular by nature A functional protein tertiary structure may consist of two or more functional ... the RNA and the base pairings that is found in the folded structure of the RNA 1.3.1 Current approaches on finding RNA secondary structure As mentioned earlier, the secondary structure arises from ... 2002, by permission of Garland Science LLC Reproduced by permission of Garland Science/Taylor and Francis LLC Figure 2.3: The tertiary structure of RNA This figure is adapted from Molecular Biology...
- 163
- 306
- 0
Characterisation of the effects and mechanism of action of rapamycin and genistein on acute myeloid leukemia using high throughput techniques
... Figure 4.3 Hierarchical clustering of transcriptomic profiles of microarray data 78 Figure 4.4 Linear regression analysis of fold-changes of regulated genes identified from microarray and real-time ... the reproductive tracts of females GEN is also known to reduce the risk of prostate cancer in men Dietary GEN regulates sex steroid receptor and growth factor ligand and receptor mRNA expression, ... major providers of microarray solutions DNA microarray is composed of thousands of DNA probes arranged as an array on a solid surface to interrogate the abundance and/ or binding ability of DNA or...
- 202
- 319
- 0
DNA chip platform a high throughput genotyping technology for genetic diagnosis and pharmacogenetic profiling
... PCR: polymerase chain reaction RBC: red blood cell RDB: reverse dot-blot RFC: reduced folate carrier RFLP: restriction fragment length polymorphism ROC: Receiver operating characteristic s: second ... Dana Farber Cancer Institute DGGE: denaturing gradient gel electrophoresis DHFR: dihydrofolate reductase DHPLC: denaturing high- performance liquid chromatography DNA/RNA: deoxyribonucleic/ribonucleic ... laboratory for their warm friendship and making me part of this research family Finally, my projects would not have started without financial aid from NUS research scholarship generously provided...
- 204
- 403
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25