occurrence antibiotic resistance and pathogenicity of non o1 vibrio cholerae in

Báo cáo khoa học: Broad antibiotic resistance proﬁle of the subclass B3 metallo-b-lactamase GOB-1, a di-zinc enzyme potx

... (5Â-GATCTTGCTGCTTACTAACGCTCACTACGACC ATACAGG-3Â) (5Â-GCACCTGTATGGTCGTAGTGAGCGTTAGTAAG CAGC-3Â) For the Q116H mutant forward and reverse: (5Â-GATCTTGCTGCTTACTCATGCTCACTACGACC ATACAGG-3Â) (5Â-GCACCTGTATGGTCGTAGTGAGCATGAGTAA ... (5Â-GCACCTGTATGGTCGTAGTGAGCATGAGTAA GCAGC-3Â) Production and purication of the zinc b-lactamase LB medium (100 mL) containing 50 lgặmL)1 kanamycin was inoculated with a colony of E coli BL21-DE3 carrying ... Summary of zinc binding for wild-type and mutants GOB1 Standard deviation values were below 10% Apo-GOB-1 and the remetallated form Zn2+ content in a buffer containing less than 0.4 lM of free zinc...

12
406
0

báo cáo hóa học:" Characteristics of non-AIDS-defining malignancies in the HAART era: a clinico-epidemiological study" doc

Danh mục: Hóa học - Dầu khí

... not of a NADM [30] We were unable to find such association in our study in multivariate analysis NADM are now a leading cause of death in HIV patients on HAART In 2005 in France, 34% of deaths in ... participated in the study design, reviewed the clinical charts, performed data analysis and statistical analysis, and writing of the paper SDW participated in the study design, data analysis, and ... incidence of bladder cancer in women and in the combined sample of both women and men The incidence of bladder cancer is increased in transplant patients but not in HIV patients [8] Data regarding...

7
385
0

Báo cáo khoa học: "Analysis of Salmonella enterica serotype Enteritidis isolated from human and chickens by repetitive sequence-PCR fingerprinting, antibiotic resistance and plasmid profiles" ppsx

Danh mục: Báo cáo khoa học

... setalosI deilppa saw noitisop dnab eht ni %5 fo ecnarelot a dna ,)ynamreG ,artemoiB( erawtfos sisylanA gnisu dezylana erew etalosi hcae fo AND dimsalp dna stcudorp RCP-per rof snrettap dnaB )aeroK ,reenoiB( ... ,remirp hcae fo lomp 02 ,etalosi hcae fo AND lm gniniatnoc emulov lm 52 a ni deraperp erew serutxim RCP )'3-G CAG TCG CAG CGG AAC GGC ATC-'5( R1AXOB dna )'3-G CGA GTG GGG TCA GTG AAT GAA-'5( 2CIRE ... seinoloc laudividni 3-2 ,noitalosi AND roF snoitacifidom ronim htiw ]32[ civolasreV yb debircsed sa yllaitnesse demrofrep saw RCP qa T la te RCP )ASU ,ocfiD( snegitna )H( allegalf dna )O( llaw...

5
211
0

Tài liệu Study on the Development and Marketing of Non-Market Forest Products and Services ppt

Danh mục: Tiếp thị - Bán hàng

... run off Increasing of the total annual river run off Flood protection Maintenance of arable land Wind and shoreline erosion Siltation prevention Maintenance of productivity on arable land Maintenance ... of heritage of natural ecosystems Holy forests Sacred plants and animals Landscape features (mountains and waterfalls) Intellectual development Nature as a motive in film, books, painting, folklore, ... Forest Agency 24 Spain - Regional Govern of Spain: Castilla-La Mancha 25 Spain- Catalonia: Department of Environtment and Housing (Government of Catalonia) 26 Spain - Conselleria de Medio Ambiente,...

102
846
0

Study on the Development and Marketing of Non-Market Forest Products and Services potx

Danh mục: Tiếp thị - Bán hàng

... provide innovative examples of financing mechanisms, which would be used for detailed analysis and material for a multi-criteria analysis (MCA) of alternative financing mechanisms In total, 35 cases ... The main task of the evaluation of financing mechanisms, within the MCA, was to assign importance weights and performance scores to the criteria of financing mechanism1 in each case The evaluation ... non- users or both; geographical scope (local, regional, national, international); (iii) data availability (e.g restricted data access – data on house values); (iv) available time and financial...

145
500
0

Study on the Development and Marketing of Non-Market Forest Products and Services pptx

Danh mục: Tiếp thị - Bán hàng

... exchange and availability of information to all market participants Furthermore, a number of social and institutional factors may stand against the development of markets, e.g traditional user ... geographical scope (local, regional, national, international); (iv) data availability (e.g restricted data access – data on house values); (v) available time, financial and personnel resources Valuation ... big and constantly changing Meaning that new goods and services are appearing or already existing goods and services are used in new ways The reasons for this are the constantly changing uses and...

14
386
0

Báo cáo toán học: " Influence of different flow conditions on the occurrence and behavior of potentially hazardous organic xenobiotics in the influent and effluent of a municipal sewage treatment plant in Germany: an effect-directed approach" pot

Danh mục: Toán học

... matrix effects and methodological losses of analytes For the quantitation of the analytes, a 5-point (PAHs) and a 7-point (pharmaceuticals) internal standard calibration was used The limit of ... standards (≥98.00%) of diclofenac, carbamazepine, and PAH-Mix 25 (containing 16 Environmental Protection Agency [EPA] PAHs) as well as the isotopically labeled compounds used as surrogate standards ... solutions of the analytes and the internal standards were prepared both in methanol and hexane and stored at 7°C The working standard solutions were prepared by further diluting the stock standard...

13
589
0

báo cáo hóa học:" Influence of different flow conditions on the occurrence and behavior of potentially hazardous organic xenobiotics in the influent and effluent of a municipal sewage " pdf

Danh mục: Hóa học - Dầu khí

... matrix effects and methodological losses of analytes For the quantitation of the analytes, a 5-point (PAHs) and a 7-point (pharmaceuticals) internal standard calibration was used The limit of ... standards (≥98.00%) of diclofenac, carbamazepine, and PAH-Mix 25 (containing 16 Environmental Protection Agency [EPA] PAHs) as well as the isotopically labeled compounds used as surrogate standards ... solutions of the analytes and the internal standards were prepared both in methanol and hexane and stored at 7°C The working standard solutions were prepared by further diluting the stock standard...

13
475
0

Báo cáo y học: "The infectivity and pathogenicity of a foot-and-mouth disease virus persistent infection strain from oesophageal-pharyngeal fluid of a Chinese cattle in 2010" potx

Danh mục: Báo cáo khoa học

... Disease Reference Laboratory of China, Lanzhou Veterinary Research Institute, Chinese Academy of Agricultural Sciences, Lanzhou, Gansu 730046, China Aff2 Xinjiang Animal health supervision Institute, ... +86-931-8342587 Fax: +86-931-8342587 Email: liuzaixin3@hotmail.com Aff1 State Key Laboratory of Veterinary Etiologic Biology, Key laboratory of Animal Virology of Ministry of Agriculture, National Foot -and- Mouth ... The infectivity and pathogenicity of a footand-mouth disease virus persistent infection strain from oesophageal-pharyngeal fluid of a Chinese cattle in 2010 ArticleCategory : Short Report ArticleHistory...

11
321
0

Báo cáo y học: "Early recognition and treatment of non-traumatic shock in a community hospital" pot

Danh mục: Báo cáo khoa học

... hypovolemia, sepsis, cardiac pump dysfunction, and anaphylaxis Shock is a common cause of morbidity and mortality Septic shock, for instance, is the 10th leading cause of death in the United States, and ... experience, and skills of care providers operating in a system that was not necessarily designed with speed in mind In the current study, Sebat and colleagues investigated whether a systems-based team approach ... health care providers completed a standardized teaching package that included a 1-hour slide presentation and subsequent interactive classes Upon implementation, a dedicated ICU bed was kept available...

3
139
0

Báo cáo y học: "Efficacy and safety of non-invasive ventilation in the treatment of acute cardiogenic pulmonary edema – a systematic review and meta-analysis" docx

Danh mục: Báo cáo khoa học

... 84:1091-6 Takeda S, Nejima J, Takano T, Nakanishi K, Takayama M, Sakamoto A, Ogawa R: Effect of nasal continuous positive airway pressure on pulmonary edema complicating acute myocardial infarction ... Concerns have also been raised about safety issues related to non- invasive ventilation Mehta and colleagues [25] showed, in an interim analysis of an RCT, an increased risk of acute myocardial infarction ... congestive heart failure) and (clinical and trial or clinical trials or clinical trial or random* or random allocation or therapeutic use) Literature searches were also undertaken, using the same search...

18
422
0

Báo cáo y học: "hiropractic diagnosis and management of non-musculoskeletal conditions in children and adolescents" doc

Danh mục: Báo cáo khoa học

... smoke, occupational exposures, chemicals and dust, drugs including aspirin and non- steroidal antiinflammatory drugs, exercise, upper airway inflammation, weather factors and gastroesophageal reflux ... pragmatic study and may demonstrate that realistically, many infants who come for chiropractic care for infant colic are already using a medication; 45% of those in a crying study were taking ... severity and treatment in Great Britain Arch Dis Child 2004, 70:174-178 36 Australian Centre for Asthma Monitoring 2008 Asthma in Australia 2008 AIHW Asthma Series no Cat no ACM 14 Canberra: AIHW...

8
376
0

Báo cáo y học: " Estimation and correction of non-specific binding in a large-scale spike-in experiment" pot

Danh mục: Báo cáo khoa học

... based on log values, to reduce the dynamic range of the observations This version of the Naef model contains 77 parameters (2 scaling parameters a and b, and affinities for A, C and G for each ... specific binding signal and correcting for chemical saturation, which require additional large-scale datasets in which the concentration of every transcript is known Materials and methods Mapping of ... A single C and S sample was generated and an aliquot from each sample was used to create each replicate, and technical variation in the methods to generate each hybridization could result in...

19
274
0

Occurrence and fate of semivolatile organic compounds (SVOCs) in the tropical atmosphere

Danh mục: Cao đẳng - Đại học

... concentrations of SVOCs and climatic conditions were investigated at Niigata Plain of Japan based on the concurrent measurements of SVOCs in air and rain over half a year in 2001 (Takase et al., ... ratio by adsorption Scavenging ratio by dissolution Scavenging ratio for a chemical in gas Scavenging ratio for a chemical in particle Total scavenging ratio for a chemical in both gas and particle ... extraction used for quantifying SVOCs in both gaseous and particulate samples o Chapter 5: Levels, Temporal, and Seasonal Trends of Semi-Volatile Organic Contaminants In Ambient Air and Rainwater...

231
263
0

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Danh mục: Cao đẳng - Đại học

... MAP kinase, MAP kinase kinase (MAPKK) and MAP kinase kinase kinase (MAPKKK) G-protein mediated mating signaling activates Ste11, a MAPKKK in S cerevisiae Ste11, in turn, phosphorylates and activates ... crosstalk between cAMP and MAP kinase signaling pathways in U maydis pathogenicity (Lee et al 2003) Coordinated regulation of mating and pathogenicity in U maydis by the cAMP and MAP kinase signaling ... regulated by cAMP-PKA cascade, which is involved in sensing nutrients during mating and virulence, and MAP kinase cascade that senses pheromone during mating, and also regulates haploid fruiting and...

220
228
0

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Danh mục: Cao đẳng - Đại học

... SLSDYRDGLTGVKMAPERKVNGKIHKDTFTGKAASEWLMDCCTTVDRREAVEIASLFVEYELIEA LQQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHGVARDSNT QRMDKILNDAALRLLFRENLRETHCEENLSFYLDVEEFVRLCRSAVRQAQLAQSSPANSAEAKKQ ALDGVKEVMAQAYGIYNAFLAPGSPCELNIDHQLRNNLATRMTKAVGQDSAMVETLQEVMALF ... KPGSRKSLLLQQHQQQKSTTESTN AAPDSKPQRAGGIFAYAAAALDRTLSES -TTTTANTTATTTTSFTGSVIGSISRRNRRSFAALAREKTSNALANLSAIGSTTSSSLRTS TKSFLLTAFTKHFHFTFTYQEAIKAMG -QLELKVDMNTTCINVSYNIKPSLARHLL Rgs1 ... SSPANSAEAKKQALDGVKEVMAQAYGIYNAFLAPGSPCELNIDHQLRNNLATRMTKAVGQ STTS -MDGIKEIMAQAYGIYNAFLAPGSPCELNIDHQLRSNLATRMTKAVGQ -ADAVRETLAAAYGLYNAFLAPGSPCELNIDHALRNSLASRMTKAVGD LSNENCSFKKQGFKHQLKEYKPAPLTLAETHSPNASVENSHTIVRYGMDNTQNDTKSVES...

12
185
0

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

Danh mục: Cao đẳng - Đại học

... Figure 28 Inductive Non- inductive _ Figure 29 Figure 30 Inductive Non- inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D WT _ rgs1Dmgb1D magB G183Smgb1D Figure ... rgs1Dmgb1D magB G183Smgb1D Figure 35 Figure 36 MG010315 MG010105 MG09134 Control: Gamma actin MG03982 MG01173 MG01630 Figure 37 A B ...

11
227
0

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Danh mục: Cao đẳng - Đại học

... Figure 44 A WT rgs1D Solvent Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT...

9
180
0

Role of multidrug resistance associated protein 4 (MRP4 ABCC4) in the resistance and toxicity of oxazaphosphorines

Danh mục: Cao đẳng - Đại học

... MRP1/ABCC1 is capable of conferring resistance to several families of natural product drugs like PgP/ABCB1, including Vinca alkaloids (vincristine and vinblastine), anthracyclines (e.g daunorubicin ... Vinca alkaloids (vincristine and vinblastine), anthracyclines (e.g daunorubicin and doxorubicin) [36], and camptothecins [7] It seems that MRP1/ABCC1 and MRP2/ABCC2 have some substrates in common ... detected in the liver, colon, intestine, and prostate at the mRNA level and in adrenal gland, kidney, colon, pancreas, gallbladder, and liver at the protein level [44, 45] As an OAT like MRP1/ABCC1 and...

144
424
0

Synthesis and characterization of non shrinking nanocomposites for dental applications 2

Danh mục: Cao đẳng - Đại học

... risks associated with mercury in dental amalgam are debatable, it is interesting to note that the use of amalgam as a restorative material has declined rapidly in the last half-decade due to aesthetic ... organic/inorganic nanocomposites for use in a variety of applications such as performance materials and abrasion resistant coatings Incorporation of POSSTM derivatives into polymeric materials ... mentioned in Chapter 1, inadequate resistance to wear under masticatory attrition, fracture of the restorations, incomplete conversion and cross-linking, undesirable water sorption, marginal adaptation,...

235
410
0

occurrence antibiotic resistance and pathogenicity of non o1 vibrio cholerae in moroccan aquatic ecosystems a review