h auden as mirrors are lonely
Seeing things as they really are
... survive It’s as large a change as when we first got the printed book “Do you realize that the cost of higher education has risen as fast as the cost of health care? And for the middle-class family, ... retirement who are hale and hearty You cannot cut the [Social Security payments] of older people because that’s the law “So they [the Europeans] cut where they have control, which is having babies.” ... U.S history the ‘villains’ have been the ‘heroes’ during the preceding boom “In the 1880s the American public fawned on the ‘tycoons’ the way we now fawn on the superrich In the depression of the...
- 5
- 474
- 0
As Required by Section 939(h) of the Dodd-Frank Wall Street Reform and Consumer Protection Act ppt
... because the underlying assessment is the same regardless of asset class—that is, the likelihood that the bond obligations will be repaid in accordance with their terms.” 124 However, the authors ... ensure that the NRSRO promptly publishes on an easily accessible portion of its website material changes to the procedures and methodologies, the reason for the changes, and the likelihood the changes ... the obligation An adequate level of capacity to honor the financial commitment on the obligation However, this capacity is more likely to diminish in the future than in the cases of the higher...
- 60
- 477
- 0
Bacteria are often maligned as the causes of human and animal disease (like this one, Leptospira, which causes serious disease in livestock)
... probability that the disease will progress to the second phase, resulting in complications which eventually lead to death (Mupapa et al., 1999) Stage II (Specific): - Hemorrhage - neuropsychiatric ... ocular diseases (ocular pain, photophobia and hyperlacrimation) - hearing loss - unilateral orchitis( inflammation of one or both of the testes) ** These conditions are usually relieved with the treatment ... motivation based on ideas of right and wrong when dealing with the geographical distribution of animals and plants This concept of can be used to explain the world’s shockingly small response to the...
- 15
- 782
- 0
Báo cáo khoa học: Identification of RNase HII from psychrotrophic bacterium, Shewanella sp. SIB1 as a high-activity type RNase H pot
... E coli RNase HI, Bsu-RNase HIII, and Bst-RNase HIII are higher than E coli RNase HII, Bsu-RNase HII, and Bst-RNase HII by 13, 20, and 100 times, respectively These results suggest that bacterial ... 2006 The Authors Journal compilation ª 2006 FEBS H Chon et al High-activity type RNase HII from a psychrotroph RNase HII at 15 and 30 °C were 18- and 14-fold higher than those of E coli RNase HII, ... cells We have shown that the SIB1 genome contains the rnhB gene encoding RNase HII We have previously shown that this genome also contains the rnhA gene encoding 2270 RNase HI [33] Thus, the SIB1...
- 12
- 371
- 0
The a and b adapters are used as priming sites for both amplification
... timed schedule PYROSEQUENCING The Chemical Chain • The nucleotide bases are added in a timed fashion (beginning with A, T, G, C with 10s between each nucleotide and a successive apyrase wash, followed ... + O2 (luciferase) AMP + oxy-luciferin + PPi + CO2 + light • A CCD camera records the light from the reaction • A wash of apyrase is released after each nucleotide to remove the unincorporated ... followed by the next nucleotide.) • As a bi-product of incorporation, DNA polymerase releases a pyrophosphate molecule (PPi) • The sulfurylase enzyme converts the PPi into ATP PYROSEQUENCING The Fireworks...
- 19
- 390
- 0
Báo cáo khoa học: Alizarine derivatives as new dual inhibitors of the HIV-1 reverse transcriptase-associated DNA polymerase and RNase H activities effective also on the RNase H activity of non-nucleoside resistant reverse transcriptases pot
... toward the RNase H catalytic site According to this mechanism, the AQs inhibit the RT-associated RNase H by avoiding the correct anchorage of the primer grip to the nucleic acid, whereas they inhibit ... substrate the RNase H activity was measured as described previously [22] When the tC5U p12 hybrid was used as reaction substrate the RNase H activity was measured as described [20,39] The RDDP ... where the ligand charges are substituted with the new charge sets calculated in the second step The extra-precision mode of Glide, which has a higher penalty for nonphysical interactions, was...
- 14
- 425
- 0
C H A P T E R 35 P Types of Poems Poetry POETRY SHARES many of the same elements as fiction, but doc
... shows how stubborn his father was b It shows how little he knew his father c It shows how blind his father was to his needs d It shows how little attention his father paid to things around him ... frightened by the thought of freedom that is coming to her Thus, choice a is incorrect There is no evidence that she has been criticized (choice b) or that she has been told she was ill (choice ... learn in the passage, what relationship you think Mrs Mallard had with her husband? a She loved him, but he did not love her b He loved her, but she did not love him c They loved each other and...
- 48
- 572
- 0
Module V Viruses and Worms.Introduction to VirusComputer viruses are perceived as a threat to potx
... of h t code without making any changes t th l tt d its d t the beginning f host d ith t ki h to the latter one Intrusive Virus: • O Overwrites the h i h host code partly, or completely with viral ... (encrypted) Polymorphic Code A well-written polymorphic virus therefore has no parts that stay the same on each infection To enable polymorphic code, the virus has to have a polymorphic engine (also ... problems Ethical and Legal Reasons: • There are ethics and legalities that rule why virus and worms are damaging Psychological Reasons: These are: y g • Trust Problems • Negative influence • Unauthorized...
- 38
- 207
- 0
Báo cáo toán học: "Dense H-free graphs are almost (χ(H) − 1)-partite" docx
... Zarankiewicz’ theorem, showing that for any fixed graph o H, the chromatic number of H governs the minimum degree threshold at which H appears in a large graph G: Theorem Let H be any fixed graph with chromatic ... our main theorem Theorem To any graph H with chromatic number r + there is associated a constant C = C (H) such that whenever ε > is given, there is n0 for which the following holds Whenever n ... ε If biex(n, H) < n − 1, then it must be the case that there is some bipartite subgraph F of H such that F ⊆ K1,n−1 and the graph H[ V (H) \ V (F )] is (r − 1)-colourable But then there is a proper...
- 11
- 119
- 0
Báo cáo y học: "Anti-Sa antibodies and antibodies against cyclic citrullinated peptide are not equivalent as predictors of severe outcomes in patients with recent-onset polyarthritis" pdf
... of three HLA shared epitope indicates the presence of at least one of the HLA DR alleles associated with RA, as listed in the Methods section Erosion Sharp–van der Heijde (SvH) score was set as ... inflammatory rheumatic diseases other than RA: 13 had arthritis associated with skin psoriasis (present at inclusion in 12), had benign sarcoid arthritis, had spondylarthropathy, and had scleroderma ... and 60 months after the onset of inflammatory arthritis The time of onset of arthritis was assumed to be the month during which the patient indicated that joint symptoms/ signs had appeared or,...
- 12
- 683
- 0
Báo cáo y học: " Ambivalent connections: a qualitative study of the care experiences of non-psychotic chronic patients who are perceived as ‘difficult’ by professionals" docx
... offer In the beginning I had this ideal picture of day treatment, that they would comfort me and such things That did not happen though, instead when I laid down on the couch they said that I could ... repeating her discontent She did not ask one single question, all she did was whine about what I had done to her Yeah, right Well, now I go home and hang myself - how would that make her feel? [P3] Page ... that patients who are perceived as ‘difficult’ and their clinicians who perceive them as such, have very different expectations about the contact with one another The expectations patients have...
- 11
- 369
- 0
Báo cáo y học: " Membrane diffusion- and capillary blood volume measurements are not useful as screening tools for pulmonary arterial hypertension in systemic sclerosis: a case control study" pptx
... phase might modify the disease course in SScPAH, new tools that assess PAH in patients with SSc are warranted[6] In this study we evaluate whether the components of the transfer factor of the ... groups as compared with the control group,, however, between the patient groups there was no significant difference The Vc%/Dm% ratio was significantly higher in SScPAH+ as compared with SScPAH- ... exchange, and therefore in a decrease of Dm [25] Secondly, parenchymal and vascular destruction in areas of Dm and Vc in SScPAH+ compared with SScPAHDm% in SScPAH+ was significantly lower as...
- 8
- 264
- 0
Báo cáo y học: "Fully-spliced HIV-1 RNAs are reverse transcribed with similar efficiencies as the genomic RNA in virions and cells, but more efficiently in AZT-treated cells" ppt
... suggests that in the infected cells exposed to AZT, the high level of the "FSpl cDNAs" is a direct consequence of their short length NERT activity has been reported previously in non-permeabilized HIV-1 ... the development of lentivirucides [9] Because RTion of the FSpl RNAs might also escape the AZT inhibition through a higher NERT activity than FL RNA before cell infection, we therefore searched ... products, such as the minus ssDNA and U3 cDNA (Fig 1) As shown in Fig 4, and similarly to "Fspl cDNA", AZT has only little effect on the synthesis of these two short RTion intermediates This result...
- 6
- 237
- 0
Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx
... construct mhhm has activity near that of human Hyal2, showing that the central regions of mouse and human Hyal2 are responsible for most of their receptor phenotype Constructs hmhh and hhmh have activity ... localizes the protein in the membrane prior to GPI anchor addition Hyal2 construct Receptor activity (%) 20 158 305 354 447 473 hhhh mmmm 100 0.1 h mm h hmh h h hmh 0.4 12 mh hm m h mm mm h m 72 ... AAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWADRNH ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH ATQYCSWTQCHGHGRCVRRNPSANTFLHLNASSFRLVPGHTPSEPQLRPEGQLSEADLNY ATQYCSWTQCHGHGRCVRRNPSASTFLHLSPSSFRLVPGRTPSEPQLRPEGELSEDDLSY...
- 11
- 247
- 0
Designing as supplementary reading syllabus for grade 10 English gifted students at Tuyen Quang Specialized Upper Secondary school = Thiết kế chương trình đọc h
... SCHOOL THIẾT KẾ CHƢƠNG TRÌNH ĐỌC HIỂU BỔ TRỢ CHO H C SINH LỚP 10 CHUYÊN ANH TRƢỜNG THPT CHUYÊN TUYÊN QUANG MINOR PROGRAMME THESIS FIELD: METHODOLOGY CODE: 601410 SUPERVISOR: Dr HOÀNG THỊ XUÂN HOA ... the part of the reader That action involves the use of the existing knowledge that the reader has on the topic of the text as well as the text itself in order to create meaning From these ideas ... students, who are the objects of this study 1.3 Summary In this chapter, the author has revealed the literature review of syllabus design and reading theories, which will be the theoretical background...
- 81
- 890
- 0
AN INVESTIGATION INTO THE USE OF PRESENTATION-REFLECTION ASSIGNMENTS IN THE AMERICAN STUDIES SYLLABUS AT ULIS-VNUH: RELEVANCE AND EFFICACY AS PERCEIVED BY LECTURERS AND STUDENTS Nghiên cứu về việc Sử dụng Bài tập Thuyết trình-Viết Thu hoạch trong Bộ môn H
... teachers and students were satisfied with what the assignment had helped the students prepare for their further study in the discipline (if they had a chance to) It seemed that when judging things ... ULIS-VNUH think the design of the courseworks have helped to meet the course's objectives? Chapter 1: Introduction ii To what degree they think the actual assignment quality has met the assignments' ... ii To what degree they think the actual assignment quality has met the assignments' requirements? iii What they suggest about modifying the assignments? 2.2 Participants As the research scope...
- 43
- 695
- 0
Palladium(II) catalyzed oxidative functionalization of c h bonds using alkyne as building block
... Functional group HOAc Acetic acid HMPT Hexamethylphosphorous triamide HRMS High resolution mass spectrometry KIE Kinetic isotope effect LiHMDS Lithium bis(trimethylsilyl)amide Me Methyl Mes Mesitylene ... reaction has not been elucidated, the ortho-C -H bond was apparently cleaved After this pioneering study, many research groups have reported about the cleavage of C -H bonds via the use of stoichiometric ... C -H activation mechanisms Shul’pin divided all the C -H bond splitting reactions which are promoted by metal complexes into three groups based on their mechanisms.[11] Crabtree labeled the mechanisms...
- 282
- 1,202
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ chỉ tiêu chất lượng 9 tr 25