cross talk in the responses to k nh 4 no 3 − and pi
Environmental Adaptations and Stress Tolerance of Plants in the Era of Climate Change pptx
... tobacco BY2 cells (Hoque et al 2007) 2.2 Amino Acids, Proline, and Amides It has been reported that amino acids (such as alanine, arginine, glycine, serine, leucine, and valine, the nonprotein ... nonprotein amino acids citrulline and ornithine (Orn)), together with the imino acid Pro, and the amides such as glutamine and asparagine are accumulated in higher plants under salinity and drought ... 1-galactono-1,4lactone exhibit increased tolerance to ozone Planta 2 14: 38 3 39 1 Mahajan S, Tuteja N (2005) Cold, salinity and drought stresses an over view Arch Biochem Biophys 44 4: 139 –158 Mäkelä...
- 532
- 8,004
- 1
Báo cáo y học: "Natural History and Clinical Consequences of Hepatitis B Virus Infection"
... America, Northern Europe, India, and Africa Genotype B and C are common in Asia; genotype D, in southern Europe, the Middle East, and India; genotype E, in West Africa and South Africa; genotype F, in ... in the population declined from 35 % to 3% in 15 years after the introduction of the vaccination program in newborns and the completion of a mass vaccination catch up program [10] In Taiwan, the ... Hence, further research and understanding in this sector may bring exciting new information and better understanding of the natural history of HBV and supplement our existing armamentarium to combat...
- 5
- 450
- 0
MÔ HìNH HOá QUá TRìNH TRAO ĐổI NHIệT ẩM TRONG MáY ấP TRứNG GIA CầM Modeling of heat and mass transfer in chicken egg incubators
... fa A.y (22) với hfa entanpi riêng không khí ẩm đợc t nh theo khối lợng không khí khô Tơng tự & & vậy, dòng entanpi không khí ẩm H fa đợc t nh theo lu khối không khí khô mdra : & & H fa = mdra ... T ln (40 ) 3 .4 Mô h nh to n học tr nh trao đổi nhiệt ẩm vùng chứa trứng Từ mô h nh động học (6) phơng tr nh nhiệt độ độ ẩm dòng khí trứng (35 ), (36 ) (38 ) ta xác đ nh đợc hệ phơng tr nh mô tả ... (31 ) H fT = mdrT hT = (1 ) drT A.h fT y (32 ) Năng lợng sinh tr nh phát triển phôi đợc xác đ nh theo khối lợng trứng hệ số sinh nhiệt phôi: & QP = (1 ) drT hP A.y (33 ) Thay phơng tr nh (31 ),...
- 9
- 1,498
- 4
An experimental investigation of heat transfer and fluid flow in a rectangular duct with inclined discrete ribs
... of the continuous rib The present investigation was therefore, taken up to determine the optimum width of a gap in the inclined rib to form discrete rib This study will help in determining the ... is that the gap in the inclined rib releases the air partly belonging to the secondary flow and partly belonging to the main flow through the gap As a result of the presence of gap, the secondary ... transfer in a square duct and reported that a gap in the inclined rib accelerates the flow and enhances the local turbulence which will result in an increase in the heat transfer They reported that the...
- 12
- 831
- 0
Evaluation of heat pumps usage and energy savings in residential buildings
... (-2.618)*** 4. 740 0.000*** 0 .32 2 0.251 Panel B 44 8.1 (0. 630 3) 592 .4 (1.180)** 46 5.5 (1.9 54) ** 111.2 (2.00)** -3. 260 (-0. 03) -198 .3 (-0. 741 ) 1 34 . 6 (1. 036 ) -2880 ( -4. 720)*** 4. 916 0.000*** 0 .32 6 0.260 ... largely offsetting efficiency gains in the conventional end-uses of heating, cooling and water heating [7] The present work focuses on determining the efficacy of using heat pumps as the main source ... monthly energy intensity during the heating season Mean difference1 (1-2) -49 042 41 P-Value 600 637 7 Mean Other Heating Methods (2) 10910618 572 03 3 036 59 - 246 456 000*** 000*** *** denotes statistical...
- 10
- 466
- 0
CONSEQUENCES OF THE NEOLITHIC
... cultivation in southern China and at the time was being introduced to Indonesia, and southern India And finally the chicken – that jungle fowl domesticated in Southeast Asia – began to reach the Middle ... into brewing at least nineteen kinds of beer.22 Winemaking also stretches back into hazy times The earliest archeological evidence indicates that wine was made at a Neolithic site in the northern ... yams, and bananas; in Africa, south of the Sahara, there were other yams and another kind of rice; and in the Americas, maize, manioc, squash, sweet and white potatoes, tomatoes, chilli peppers and...
- 9
- 299
- 0
Tài liệu The long-term reproductive health consequences of female genital cutting in rural Gambia: a community-based survey doc
... 9 /48 1 240 /42 7 16 /42 1 1 /45 2 36 /45 8 48 /42 7 2 23 /42 6 47 /32 9 35 /35 6 78/182 75 /48 0 226 /46 3 56
- 11
- 558
- 0
Tài liệu THE HEALTH CONSEQUENCES OF SMOKING pptx
... prepared to emphasize the fact that the major health risks from smoking are know" and that recent scientific information refines the understanding of these relatlonshlps Without doubt cigarette smoking ... unavoidable, and the important k now is to convert this knowledge into programs for reducing d eliminating the preventable death and disability related to the oking habit E Theodore Cooper, M.D Assistant ... the scientific literature available to the National Clearinghouse for Smoking and Health and with emphasis on the most recent additions to the literature was that updated report Since then, the...
- 12
- 414
- 0
Tài liệu Báo cáo khoa học: Nucleolin/C23 mediates the antiapoptotic effect of heat shock protein 70 during oxidative stress pptx
... inducible 70-kD heat stress protein in a transgenic mouse increases the resistance of the heart to ischemic injury J Clin Invest 95, 144 6– 145 6 Jayakumar J, Suzuki K, Khan M, Smolenski RT, Farrell ... antagonizes apoptosis-inducing factor Nat Cell Biol 3, 839 – 8 43 24 Jiang B, Wang K, Xiao W, Wang H & Xiao X (2009) ATP-binding domain of heat shock protein 70 is essential for its effects on the inhibition ... & Lakatta EG (1998) Enhanced expression of p 53 and apoptosis induced by blockade of the vacuolar proton ATPase in cardiomyocytes J Clin Invest 101, 145 3 146 1 34 Long X, Boluyt MO & Hipolito ML...
- 11
- 614
- 0
Tài liệu Consequences of Voluntary and Mandatory Fair Value Accounting: Evidence Surrounding IFRS Adoption in the EU Real Estate Industry docx
... disclosure, and the capital markets: A review of the empirical disclosure literature Journal of Accounting and Economics 31 : 40 5 -44 0 International Accounting Standards Board (IASB) 20 03 International ... 0.121 0 .36 3 12.5 23 0. 938 0. 041 12.8 23 1 .42 5 0. 046 12.650 0.992 0. 041 p-value 0 .32 3 –0.159 0.0 03 Control Variables: SIZE DEBT_MCAP CFO_MCAP 12.500 1.5 84 0. 0 43 0 .48 0 .30 0.08 *
- 43
- 517
- 0
Tài liệu Báo cáo khoa học: Novel aspects of heat shock factors: DNA recognition, chromatin modulation and gene expression ppt
... univer- FEBS Journal 277 (2010) 41 40 41 49 ª 2010 The Authors Journal compilation ª 2010 FEBS 41 47 HSF–HSE interaction 34 35 36 37 38 39 40 41 42 43 44 H Sakurai and Y Enoki sal, transcriptional requirement ... H Sakurai and Y Enoki HSF–HSE interaction H1 S1 S2 H2 Turn H3 S3 Wing S4 Linker Kl PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENENFKR Sc PAFVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSIQSSSDDKWQFENENFIR ... Acids Res 38 , 144 1– 144 9 FEBS Journal 277 (2010) 41 40 41 49 ª 2010 The Authors Journal compilation ª 2010 FEBS H Sakurai and Y Enoki 58 Kremer SB & Gross DS (2009) The SAGA and Rpd3 chromatin modification...
- 10
- 565
- 0
Tài liệu Báo cáo khoa học: Roles of heat shock factors in gametogenesis and development pptx
... directly or indirectly involved in cytoskeleton dynamics (Hsp90 and cortical actin in eggs [33 , 34 ] ; p35 ⁄ p39 ⁄ Cdk5 [1 23] ; bIV tubulin in ciliary-beating activity [ 149 ]; and Bfsp, lens-specific intermediate ... genes, p35 and p39, encoding p35 and p39, the activators of Cdk5, a kinase essential for migration known to be involved in migration and modulates their expression [1 23, 137 ] As a consequence, Cdk5 ... HSF4 on chromatin In the absence of HSF4, histone H 3K9 methylation is induced and HSF1 binding is reduced, indicating that HSF4 facilitates HSF1 binding via chromatin remodelling Heat shock genes...
- 23
- 796
- 0
Tài liệu Báo cáo khoa học: Analysis of oxidative events induced by expanded polyglutamine huntingtin exon 1 that are differentially restored by expression of heat shock proteins or treatment with an antioxidant ppt
... through their ability to increase glucose-6-phosphate FEBS Journal 2 73 (2006) 30 76 30 93 ª 2006 The Authors Journal compilation ª 2006 FEBS 30 91 Huntingtin inclusions and oxidation 44 45 46 47 48 49 ... dysfunction in mice transgenic for the HD mutation Cell 90, 537 – 548 Bates G (20 03) Huntingtin aggregation and toxicity in Huntington’s disease Lancet 36 1, 1 642 –1 644 Saudou F, Finkbeine S, Devys ... Hdj-1(Hsp40) can inhibit self-assembly of polyglutamine proteins into amyloid-like fibrils [39 ] and are associated with aggregates in the brains of HD transgenic mice [40 ] Hsp70 and Hdj-1 can inhibit...
- 18
- 721
- 0
Tài liệu Báo cáo khoa học: Consequences of COP9 signalosome and 26S proteasome interaction doc
... human CSN2 and the PCI domain of human Rpn6 (Rpn6 amino acids 291– 42 2) were linked together and cloned into an eukaryotic expression vector possessing a N-terminal Flag-tag (Fig 3A) The construct ... whether substitution of the PCI domain of CSN2 by the PCI domain of Rpn6 has consequences for the complex integration of the chimerical CSN2-Rpn6 protein The cDNA encoding the first 34 3 amino ... antibodies against subunits of the CSN as well as the 26S proteasome According to the data shown in Fig 3C the Flag-CSN2-Rpn6 protein was not integrated into either an intact CSN or lid complex The Flag...
- 9
- 539
- 0
The Health Risks and Consequences of Trafficking in Women and Adolescents pot
... trafficked to Kosovo and Yugoslavia, one woman worked in Italy and the UK, and one worked in Greece and Italy Of the 28 women interviewed, 25 had been trafficked into sex work, and three into domestic ... never in the face because they didn’t want to ruin the merchandise Sometimes I was kicked in the stomach and in the legs Oskana, Ukraine to Italy I was delivered to one of the houses near the forest ... they still took me to the client to provide sexual services So started my stay in Turkey, not knowing the language, not having documents or money Tamara, Ukraine to Turkey Reported injuries and...
- 130
- 639
- 0
Preparing for the Psychological Consequences of Terrorism: A Public Health Strategy ppt
... Medicine is a relief carving from ancient Greece, now held by the Staatliche Museen in Berlin “Knowing is not enough; we must apply Willing is not enough; we must do.” —Goethe Shaping the Future ... as avoiding air travel, increasing smoking, or increasing alcohol consumption Other behavioral changes may include gathering information about actions to take in response to the event or in preparation ... skills, and training for key health and human services providers; and handle the anticipated increase in demand for mental health services From the input of the workshop, the committee will: INTRODUCTION...
- 185
- 423
- 0
Báo cáo khoa học: Temporal expression of heat shock genes during cold stress and recovery from chill coma in adult Drosophila melanogaster pdf
... FEBS 1 83 Heat shock response to cold stress 38 39 40 41 42 43 44 45 46 47 48 49 50 51 1 84 H Colinet et al borer, Chilo suppressalis Walker Arch Insect Biochem Physiol 63, 3 647 Goto SG & Kimura ... 1 04, 11 130 11 137 30 Kos tal V & Tollarova-Borovanska M (2009) The 70 kDa heat shock protein assists during the repair of chilling injury in the insect, Pyrrhocoris apterus PLoS ONE 4, e4 546 , ... role in cold tolerance Hsp22 is a key player in cell protection against oxidative injuries [42 ], a typical feature of chilling injury [ 43 ] In addition, sHsps are effective in preserving the integrity...
- 12
- 388
- 0
Consultative Document Capitalisation of bank exposures to central counterparties pptx
... require the Committee to prioritise factors other than its bank capitalisation risk mandate (eg assisting CPSS-IOSCO in performing its duties or improving liquidity in the banking system) Other responses ... entitled) to the transfer of the collateral belonging to clients of a defaulting clearing member to the CCP, to one or more other surviving clearing members or to the client or the client’s nominee ... Non-qualifying CCPs 118 Banks must apply the Standardised Approach for credit risk in the main framework, according to the category of the counterparty, to their trade exposure to a non-qualifying CCP...
- 26
- 378
- 1
Báo cáo khoa học: Differential recognition of heat shock elements by members of the heat shock transcription factor family ppt
... 3, and 4) , a gap-like HSE (units 3, 4, and 6), and a step-like HSE (units 2, 4, and 6); the m2 reporter gene contained a gap-like HSE (units 3, 4, and 6); the m3 reporter contained a step-like ... human heat shock transcription factor Mol Cell Biol 15, 43 19 43 30 34 Fujimoto M, Oshima K, Shinkawa T, Wang BB, Inouye S, Hayashida N, Takii R & Nakai A (2008) Analysis of HSF4 binding regions reveals ... and protection from stress Genes Dev 17, 516–528 43 Trinklein ND, Chen WC, Kingston RE & Myers RM (20 04) Transcriptional regulation and binding of heat shock factor and heat shock factor to 32 ...
- 13
- 507
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008