a plant protein storage vacuole sorting receptor

Ngày tải lên: 30/03/2014, 04:20

... PAGE separation of FN3d–AP purified from conditioned media using anti-placental alkaline phosphatase (PLAP) agarose. (C) SDS ⁄ PAGE and silver stain of proteins isolated from AP sepharose (lane ... isothiocyanate; HB-19, 5[Kw(CH 2 N)PR]-TASP; HSPG, heparin sulfate proteoglycan; PLAP, placental alkaline phosphatase; PTP, protein tyrosine phosphatase; RAP, receptor affinity probe; RPTP, receptor protein ... charged plates and incubated with various concentrations of FN3d–AP supernatant. Binding of FN3d– AP was determined by alkaline phosphatase (AP) activity measured at 405 nm. The reaction rate...

Ngày tải lên: 19/02/2014, 05:20

... activities. Eur. Cyt. Netw. 8, 359–365. 36. Fukada, T., Hibi, M., Yamanaka, Y., Takahashi Tezuka, M., Fujitani, Y., Yamaguchi, T., Nakajima, K. & Hirano, T. (1996) Two signals are necessary ... is substantially independent of the JAK/STAT pathway. DISCUSSION We have successfully expressed an active fusion protein of human CNTF and human soluble CNTF-R in mammalian cells. Hyper-CNTF has a calculated ... polyclonal rabbit anti-(phospho-STAT3) Ig and anti- (phospho-p44/42 MAP kinase) Ig. As secondary reagent, horseradish peroxidase (HRP)-conjugated goat anti-(rabbit IgG) Ig was used (Sigma, Deisenhofen,...

Ngày tải lên: 22/02/2014, 07:20

Ngày tải lên: 08/03/2014, 08:20

Ngày tải lên: 15/03/2014, 00:20

... aa 208 aa 24 aa BamH 34 aa Start Stop Xho1 N -Pro Protease domain Protease domain CT - ex 380 aa 1 II NP 114 aa 208 aa BamH1 34 aa Start Stop Xho1 SS SS G SSS S N-Pro 356 aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B 66 ... of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism Sruti Dutta, Debi Choudhury, Jiban K. Dattagupta and Sampa Biswas Crystallography and Molecular ... protease from the latex of Ervatamia coronaria. Biosci Biotechnol Biochem 62, 1947–1955. 15 GuhaThakurta P, Biswas S, Chakrabarti C, Sundd M, Jagannadham MV & Dattagupta JK (2004) Structural basis...

Ngày tải lên: 14/02/2014, 14:20

... sequencing and mutational analysis of a gene cluster involved in nitrite reduction in Paracoccus denitrificans. Antonie Leeuwenhoek 66, 111–127. 13 Kawasaki S, Arai H, Kodama T & Igarashi Y (1997) Gene ... FEBS 23 Chang CK (1994) Heme d 1 and other heme cofactors from bacteria. Ciba Found Symp 180, 228–238. 24 Van Spanning RJ, Wancell CW, De Boer T, Hazelaar MJ, Anazawa H, Harms N, Oltmann LF & ... in a mutant that lacks NirF; this too is not trivial as the DnirF strain does not accumulate readily detectable amounts of an intermediate of d 1 synthesis. Experimental procedures DNA manipulations DNA...

Ngày tải lên: 15/02/2014, 01:20

... QuikChange site-directed mutagenesis kit (Stratagene, La Jolla, CA, USA). Plasmid pET-1TK was used as template and Kleb(HtoA)fw (5¢-GCTTAGCCGCGCCGGCATTCG) and Kleb(HtoA)rv (5¢-CGAATGCCGGCGCGGCTAAGC) ... phytate with pH optima in the acidic range. They consist of two domains, a large a ⁄ b domain and a small a domain with the catalytic site at the interface of the two domains [4,5]. HAPs can initi- ate ... to different habitats. To support plant growth, bacteria do not need to release phosphate as fast as the diges- tive tract of an animal host, where possible substrates might be available for a limited...

Ngày tải lên: 16/02/2014, 09:20

... (5¢-TACCGTTAACATCGATATGCATCATCATC ATCATCATGC-3¢) was designed to insert a ClaI restric- tion site at nucleotide position )6, whereas the reverse primer (5¢ -ATCGCCATGGTCCCGGGCATATGGGATC CCTGGAAGTACAGGTTTTCCTTTTTAATGGGTGTC CC-3¢) ... to thank Antonino Natalello and Silvia Maria Doglia for their assistance with the fluorescence spectroscopy, as well as for critically reading the manuscript. We are indebted to Maria Samalikova ... (5¢-TAC CTGGCCAATGAATATGCATCATCATCATCATCATA CTCCGTCGACCCCACC-3¢) designed to introduce a hexahistidine tag and a ClaI restriction site at nucleotide position –6 and a reverse primer (5 ¢ -A TCGCCATGGTC CCGGGCATATGGGATCCCTGGAAGTACAGGTTTT CGCCATGCTCTTGATCCC-3¢)...

Ngày tải lên: 18/02/2014, 04:20

... CGCTATTACCATGGTGATGC (nucleotides 4588–4608 of PCMV-Sport–b-gal plasmid) Sense ARS with PstI and SalI CGGTTCACTAAACGAGCTCTGCTGCAGaaaaaatccaaaaaaaatctaaaaaaatcttttaaaa aaccccaaaaaaatttacaaaaaaGTCGACaatgc Antisense ... overall CMV β-gal β-gal β-gal β-gal (1) β-gal A C D B (2) ARS-β-gal CMV AR S 5’-aaaaaatccaaaaaaaatctaaaaaaatcttttaaaaaaccccaaaaaaatttacaaaaaa-3’ (3) TOP-β-gal CMV (4) TOP-ARS-β-gal 5’-ccttctccccggcggttagtgctgagagtgc-3’ ... aaaaaatccaaaaaaaatctaaaaaaatcttttaaaaaaccccaaaaaaatttacaaaaaa S. Ma et al. PABP expression during heat shock recovery FEBS Journal 276 (2009) 552–570 ª 2008 The Authors Journal compilation ª 2008...

Ngày tải lên: 18/02/2014, 12:20

... colon carcinoma and rectal carcinoma as compared to normal colonic tissue. Colon carcinoma cells, rectal carcinoma cells and their normal healthy tissue counterparts were harvested ( 1a, carcinoma ... C) Subcellular protein fractionation. Chemical fraction of cell pellets after FLAG–s-DAPK transfection into a cytosolic (A) and cytoskeletal (B) fractions for Flag–s-DAPK or Flag–s-DAPK-1Dtail (TD) as ... vitro at a faster rate than GST alone (Fig. 2E), supporting the existence of a protease that cleaves s-DAPK-1 protein in vivo. The reason why the cleavage band was not observed in this assay may...

Ngày tải lên: 18/02/2014, 17:20

... domain proteins; Y-box protein; polypyrimidine tract binding protein; mRNA stabilization; vascular endothelial growth factor. VEGF is an essential regulator of angiogenesis that acts on vascular ... as is observed for the IL-2 mRNA [31–33], and general mRNA stabilization [34–37]. PTB proteins may also play a role in general mRNA stabilization [62]. To investigate a role for the VEGF mRNA ... proteins have been shown to play a role in both induced [31–33] and general [34–37] mRNA stabilization. Recent data suggests that PTB proteins may also play a role in this latter type of mRNA...

Ngày tải lên: 19/02/2014, 12:20

... transmembrane domains, an intracellular loop and an extracellular C-terminus. a4 /b2 Receptors, which mainly control pain [7], and a7 receptors are the most abundant nAChR subtypes in the mammalian ... therapeutic application, whilst maintaining their other remarkable features. We have generated homology models of several nAChR subtypes [2 7a] , so that we can start to analyse in detail the nAChR pharmacophore ... this information with the powerful computational tools available today is facilitating drug design at the nAChRs. Acknowledgements We thank Joel Tyndall, Christina Schroeder and Ivana Saska for their comments...

Ngày tải lên: 19/02/2014, 12:20

... Queensland, Brisbane, QLD, Australia a- Conotoxins that target the neuronal nicotinic acetylcho- line receptor have a range of potential therapeutic applica- tions and are valuable probes for examining ... a positive or negative way. Muta- tional analysis has indicated residues that are important for selectivity and potency, and structural analyses of such mutants have suggested that what appear ... mutational analysis has been carried out on ImI, PnIA, PnIB and to a lesser extent on GID and MII. Analysis of ImI has revealed that Asp5-Pro6-Arg7 and Trp10 are important for biological activity...

Ngày tải lên: 19/02/2014, 12:20

... 5¢-GAGCCCGGATCCACCATGAA GGTCTCAATAATT 3¢;3¢ primer, 5¢-CTGACG GAAT TCTTAAACATTAATGCC 3¢. These primers encoded a Kozak consensus sequence as well as BamHI and EcoRI restriction sites. The PCR-amplified ... Nomura ,A. ,Kawasaki,K.,Kubo,T.&Natori,S.(1992)Puri- fication and localization of p10, a novel protein that increases in nymphal regenerating legs of Periplaneta americana (American cockroach). ... observed with M. brassicae CSPMbraA6 [32]. We observed also that BrC15-Ac was able to displace ASA, suggesting that brominated fatty acid and ASA both associated with W81 in the same ligand binding...

Ngày tải lên: 21/02/2014, 03:20

... either at the Hospital for Sick Children (Toronto, Ontario, Canada) or t he National Research Council Laboratory (Halifax, Nova Scotia, Canada). Sequence similarity amongst the p26 constructs was analyzed ... from Artemia cysts [57], and molecular mass markers o f 29 kDa (carbonic anhydrase), 66 k Da (bovine serum albumin), 150 kDa (alcohol dehydrogenase), 200 kDa (a- amylase), 443 kDa (apoferritin), and ... shock /a- crystallin protein from Artemia (Eur. J. Biochem. 269) 937 Functional analysis of a small heat shock /a- crystallin protein from Artemia franciscana Oligomerization and thermotolerance Julie...

Ngày tải lên: 22/02/2014, 04:20

... little accumulation due to receptor externalization The dynamics of appearance of additional surface sites at 30 l M PAO indicated a fast activation, as the increase in the labeling by agonist ... at 4000 g to separate the extracted (originally cell-surface attached) and the residual (internal- ized) radioactive peptide. Receptor characterization The homogenization or NPY receptor assay ... monolayers or particulates, and to dispersed rat forebrain cells. The labeled Y2 agonist was input at 50 p M in all cases. For assay details see Methods. All data, shown ± SEM, are averages of...

Ngày tải lên: 22/02/2014, 04:20

... (Sky1 and Dsk1, respectively); Candida albicans with two (QSAA48 and QS9Q27); Aspergilus niger with nine (A2 QAE4, A2 QB94, A2 QC46, A5 AB23, A2 QWQ2, A2 QX01, A2 QX98, A2 R2M0 and A2 RSV1)]; plants with ... and 1a is nega- tively affected by interaction with scaffold attachment factors B1 and 2. FEBS J 276, 5212–5227. 18 Nakagawa O, Arnold M, Nakagawa M, Hamada H, Shelton JM, Kusano H, Harris TM, Childs ... (2006) Targeting the RNA splicing machinery as a novel treat- ment strategy for pancreatic carcinoma. Cancer Res 66, 3819–3827. 57 Hishizawa M, Imada K, Sakai T, Ueda M, Hori T & Uchiyama T (2005)...

Ngày tải lên: 06/03/2014, 01:20

Ngày tải lên: 07/03/2014, 12:20

Ngày tải lên: 07/03/2014, 15:20