a biogas plant seldom

Tài liệu Báo cáo khoa học: Structural insights into the substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria ppt

Tài liệu Báo cáo khoa học: Structural insights into the substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria ppt

... coronaria Raka Ghosh, Sibani Chakraborty, Chandana Chakrabarti, Jiban Kanti Dattagupta and Sampa Biswas Crystallography and Molecular Biology Division, Saha Institute of Nuclear Physics, Kolkata, ... acid at a particular position for this family of plant cysteine pro- teases. The primers used were 5¢-TTGCCTGAGCA TGTT GATTGGAGAGCGA AAG-3 ¢ (forward) and 5¢-GGGAT AATAAGGTAATCTAGTGATTCCAC-3¢ ... S, Sundd M, Jagan- nadham MV & Dattagupta JK (1999) Crystallization and preliminary X-ray analysis of ervatamin B and C, two thiol proteases from Ervatamia coronaria. Acta Crystallogr D 55,...

Ngày tải lên: 18/02/2014, 16:20

14 635 0
Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx

Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx

... vanished after 30 min, and instead, an absorption peak appeared at 637 nm, suggesting the formation of CO–verdoheme. The 637 nm band disappeared gradu- ally and was replaced by a new broad band ... T, Zhang X, Sun D, Sato M, Sasahara M, Kayama T, Ikeda-Saito M & Yoshida T (2000) Histidine 20, the crucial proximal axial heme ligand of bacterial heme oxygenase Hmu O from Corynebacterium ... specific absorption bands. Heme catabolism by HOs of mammals, pathogenic bacteria, cyanobacteria and probably insects is considered to have a similar mechanism, because the characteristic absorption bands...

Ngày tải lên: 19/02/2014, 05:20

16 618 0
Báo cáo y học: "A Comparative Effectiveness Study of Bone Density Changes in Women Over 40 Following Three Bone Health Plans Containing Variations of the Same Novel Plant-sourced Calcium"

Báo cáo y học: "A Comparative Effectiveness Study of Bone Density Changes in Women Over 40 Following Three Bone Health Plans Containing Variations of the Same Novel Plant-sourced Calcium"

... investigators‟ DXA (Total Body Du- al-energy X-ray Absorptiometry) database, from par- ticipants at a local health fair, and from referrals from subjects who agreed to participate. All subjects ... known as „AlgaeCal‟ or „AC‟) made by milling whole, live-harvested sea algae found on the South American coastline. In addition to calcium, the algae contained other naturally occurring minerals ... 61. Marone PA, Yasmin T, Gupta RC, et al: Safety and toxicological evaluation of AlgaeCal (AC), a novel plant- based calcium sup- plement. Toxicol Mech Methods. 2010; 20:334-344. 62. Kaats GR:...

Ngày tải lên: 25/10/2012, 11:10

12 664 0
Boosting biogas yield of anaerobic digesters by utilizing concentrated molasses from 2nd generation bioethanol plant

Boosting biogas yield of anaerobic digesters by utilizing concentrated molasses from 2nd generation bioethanol plant

... meet the seasonal variation in energy demand. Biogas plant connected with CHP (combined heat and power plant) is typically designed for base load due inadequacy of the material characterized ... dietary fibres and klason lignin was analysed as described by Knudsen [13] whereas mineral analysis (primarily cations and anions) was conducted as according to Fang et al [14]. Fat was determined ... glucose and arabinose (Table 1). Although not abundant, small amount of other sugars such as rhamnose (<1g/kgTS), mannose and galactose were also observed. Furthermore, analysis quantified approximately...

Ngày tải lên: 05/09/2013, 16:10

12 763 1
Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc

Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc

... aa 208 aa 24 aa BamH 34 aa Start Stop Xho1 N -Pro Protease domain Protease domain CT - ex 380 aa 1 II NP 114 aa 208 aa BamH1 34 aa Start Stop Xho1 SS SS G SSS S N-Pro 356 aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B 66 ... of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism Sruti Dutta, Debi Choudhury, Jiban K. Dattagupta and Sampa Biswas Crystallography and Molecular ... protease from the latex of Ervatamia coronaria. Biosci Biotechnol Biochem 62, 1947–1955. 15 GuhaThakurta P, Biswas S, Chakrabarti C, Sundd M, Jagannadham MV & Dattagupta JK (2004) Structural basis...

Ngày tải lên: 14/02/2014, 14:20

13 760 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc

Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc

... QuikChange site-directed mutagenesis kit (Stratagene, La Jolla, CA, USA). Plasmid pET-1TK was used as template and Kleb(HtoA)fw (5¢-GCTTAGCCGCGCCGGCATTCG) and Kleb(HtoA)rv (5¢-CGAATGCCGGCGCGGCTAAGC) ... glucose- 1-phosphatase and human prostatic-acid phosphatase. The polypeptide chain is organized into an a and an a ⁄ b domain, and the active site is located in a positively charged cleft between the domains. ... phytate with pH optima in the acidic range. They consist of two domains, a large a ⁄ b domain and a small a domain with the catalytic site at the interface of the two domains [4,5]. HAPs can initi- ate...

Ngày tải lên: 16/02/2014, 09:20

13 766 0
Tài liệu BIOCHEMICAL TARGETS OF PLANT BIOACTIVE COMPOUNDS A pharmacological reference guide to sites of action and biological effects doc

Tài liệu BIOCHEMICAL TARGETS OF PLANT BIOACTIVE COMPOUNDS A pharmacological reference guide to sites of action and biological effects doc

... in plants used for stimulatory drinks such as Ilex paraguayensk (matC) (Aquifoliaceae), Coffea species (coffee) (Rubiaceae), Paullinia cupana (guarana) (Sapindaceae), Cola acuminata (cola) and ... alkaloids are or-glycosidase inhibitors, namely (sources in parentheses) alexine (Alexa leiopetala (Fabaceae)), australine (Castanospermum australe (Fabaceae)) and casuarine (Casuarina ... Artemisia annua (Asteraceae) is of major importance as an antimalarial because of extensive resistance of Plasmnodium falciparum to antimalarials such as chloroquine. Artemisinin in has a...

Ngày tải lên: 17/02/2014, 05:20

861 443 0
Tài liệu Báo cáo khoa học: Insights into the structure of plant a-type phospholipase D Susanne Stumpe, Stephan Konig and Renate Ulbrich-Hofmann ¨ ppt

Tài liệu Báo cáo khoa học: Insights into the structure of plant a-type phospholipase D Susanne Stumpe, Stephan Konig and Renate Ulbrich-Hofmann ¨ ppt

... fact that EDTA effects a marked stabilization (Table 1), however, indi- cates an additional destabilizing effect by calcium ions. Destabilization of PLDa2 by calcium ions was also indicated by ... protein absorbance at 280 nm. Aldolase (150 kDa), ovalbumin (45 kDa), chymotrypsinogen A (25 kDa), and cytochrome c (12.3 kDa) (Serva, Heidelberg, Germany) were used as molecular mass standards. Absorption ... (w ⁄ v) acrylamide] were stained with Coomassie Brilliant Blue G250 and quantified by densitometric evaluation at 595 nm (CD60; Desaga, Darm- stadt, Germany). Small angle X-ray solution scattering...

Ngày tải lên: 19/02/2014, 02:20

11 751 0
Tài liệu Báo cáo khoa học: 1,5-Diamino-2-pentyne is both a substrate and inactivator of plant copper amine oxidases ppt

Tài liệu Báo cáo khoa học: 1,5-Diamino-2-pentyne is both a substrate and inactivator of plant copper amine oxidases ppt

... experiments performed according to that with DABY-inactivated GPAO [8] revealed that the pI value of the DAPY-inactivated GPAO was not dramatically changed. The native GPAO is characterized by a pI of 7.2 [18]. After ... 1,5-diamino-2-pentyne (DAPY). The unsymmetrical DAPY comprises both a propargyl and homopropargyl amine. DAPY was synthesized and tested as a substrate of two plant CAOs. DAPY acts as a mechanism-based inhibitor ... mixture prepared in 0.1 M ammonium bicarbonate containing ACA as a reagent for trapping of the product aminoaldehyde, where several new peaks appeared. ACA itself is represented by a peak with m/z...

Ngày tải lên: 19/02/2014, 16:20

13 604 0
Tài liệu Báo cáo khoa học: Plant a-amylase inhibitors and their interaction with insect a-amylases ppt

Tài liệu Báo cáo khoa học: Plant a-amylase inhibitors and their interaction with insect a-amylases ppt

... inhibitor; HSA, human salivary a- amylase; LCAI, Lachrima jobi chitinase/ a- amylase inhibitor; PAI, pigeonpea a- amylase inhibitor; PPA, por- cine pancreatic a- amylase; RASI, rice a- amylase/subtilisin ... bean; AMY1 and AMY2, a- amylases from barley seeds; BASI, barley a- amylase subtilisin inhibitor; BLA, Bacillus licheniformis a- amylase; CAI, cowpea a- amylase inhibitor; CHFI, corn Hageman factor ... Brazil, Fax: + 5 5 6 1 340 3624, Tel.: + 55 61 448 4705, E-m ail: ocfranco@cenargen.embrapa.br Abbreviations: AAI, Amaranthus a- amylase inhibitor; a- AI1 and a- AI2, a- amylase inhibitors 1 and 2 from...

Ngày tải lên: 21/02/2014, 03:20

16 540 0
Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf

Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf

... L, Hamid Q & Elias JA (2004) Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13 pathway activation. Science 304, 1678– 1682. 4 Kasprzewska A (2003) Plant chitinases ) regulation ... 491–503. 24 Aronson NN, Halloran BA, Alexyev MF, Amable L, Madura JD, Pasupulati L, Worth C & Van Roey P (2003) Family 18 chitinase–oligosaccharide substrate interaction: subsite preference and anomer ... demonstrated by kinetic and molecular modeling studies. Plant Mol Biol 52, 43– 52. 26 Ueda M, Kojima M, Yoshikawa T, Mitsuda N, Araki K, Kawaguchi T, Miyatake K, Arai M & Fukamizo T (2003) A novel...

Ngày tải lên: 07/03/2014, 11:20

12 400 0
Báo cáo khoa học: Epl1, the major secreted protein of Hypocrea atroviridis on glucose, is a member of a strongly conserved protein family comprising plant defense response elicitors potx

Báo cáo khoa học: Epl1, the major secreted protein of Hypocrea atroviridis on glucose, is a member of a strongly conserved protein family comprising plant defense response elicitors potx

... Comparini C, Calamassi R, Pazzagli L, Cappugi G & Scala A (2004) Cerato-platanin protein is located in the cell walls of ascospores, conidia and hyphae of Ceratocystis fimbriata f. sp. Platani. ... 341–346. 25 Pazzagli L, Cappugi G, Manao G, Camici G, Santini A & Scala A (1999) Purification, characterization, and amino acid sequence of cerato-platanin, a new phyto- toxic protein from Ceratocystis ... Stability of clades was evaluated by 1000 bootstrap rearrangements. Bootstrap values lower than 20% are not displayed in the cladogram. RNA isolation and hybridization Fungal mycelia were harvested...

Ngày tải lên: 07/03/2014, 12:20

14 494 0
Báo cáo khoa học: Plant DNA polymerase k, a DNA repair enzyme that functions in plant meristematic and meiotic tissues docx

Báo cáo khoa học: Plant DNA polymerase k, a DNA repair enzyme that functions in plant meristematic and meiotic tissues docx

... Nagasawa, K., Kitamura, K., Yasui, A. , Nimura, Y., Ikeda, K., Hirai, M., Matsukage, A. & Nakanishi, M. (2000) Identification and characterization of human DNA polymerase b2, a DNA polymerase ... 5¢-AGCTACCATGCCT GCACGAAGAGTGCGTATTATGCCTACACTGGA GTACCGGAGCATCGTCGTGACTGGGAAAAC-3¢. [ 3 H]dTTP (10 l M ;10CiÆmmol )1 ) and enzymes were added as indicated in the figure legends, and incubated ... visualized by autoradiography. DNA substrate used in this assay is a d15:d21-mer primer/ template. The sequences are 5¢-ACTGGAGATCTGC AT-3¢ and 5¢-TGAAGCATGCAGATCTCCAGT-3¢. Misincorporation assay The...

Ngày tải lên: 07/03/2014, 15:20

9 492 0
Báo cáo khoa học: Purification of a plant nucleotide pyrophosphatase as a protein that interferes with nitrate reductase and glutamine synthetase assays pdf

Báo cáo khoa học: Purification of a plant nucleotide pyrophosphatase as a protein that interferes with nitrate reductase and glutamine synthetase assays pdf

... var. botrytis) extracts. The final preparationcontainedanacyl-CoAoxidaseandasecond protein of the plant nucleotide pyrophosphatase family. This preparationhydrolysedNADH,ATPandFADtogenerate AMP ... Sonoda, M., Ide, H., Nakayama, S., Sato, T. & Nakagawa, H. (2000) Cloning and expression analysis of nitrate reductase inactivator (NRI) gene from spinach. Plant Cell Physiol. 41, s160. 12. Kaiser,W.M.,Weiner,H.,Kandlbinder ,A. ,Tsai,C.B.,Rockel, P., ... (v/v) HCl and 24% (w/v) trichloroacetic acid. The A 504 was measured and the c-glutamyl hydroxamate produced was quantified using commercial c-glutamyl hydroxamate as standard. Control assays were...

Ngày tải lên: 08/03/2014, 08:20

7 457 0
Báo cáo khoa học: Isolation and enzymatic characterization of lamjapin, the first ribosome-inactivating protein from cryptogamic algal plant (Laminaria japonica A) ppt

Báo cáo khoa học: Isolation and enzymatic characterization of lamjapin, the first ribosome-inactivating protein from cryptogamic algal plant (Laminaria japonica A) ppt

... ribosomal RNA by lamjapin were quantita- tively analyzed by the chloroacetaldehyde method. A time course study demonstrated that the release of adenine by lamjapin continued at a linear rate for at ... the first ribosome-inactivating protein from cryptogamic algal plant ( Laminaria japonica A) Ren-shui Liu 1 , Jia-hua Yang 2 and Wang-Yi Liu 1 1 State Key Laboratory of Molecular Biology, Institute ... of rat ribosomal RNA was flipped [27]. Lamjapin could deadenylate A2 0 of SRD RNAandreleasedtheRNAfragmentwiththeexactsizeof the R-fragment from the ribosomal RNA. It is likely that lamjapin deadenylates...

Ngày tải lên: 08/03/2014, 10:20

7 480 0

Bạn có muốn tìm thêm với từ khóa:

w