1 physical and biochemical testing of urine
Tài liệu Báo cáo Y học: Structural and biochemical characterization of neuronal calretinin domain I– II (residues 1– 100) Comparison to homologous calbindin D28k domain I–II (residues 1 –93) pdf
... (G38, G72, G 110 , G163) [53,54] (C) Calb I –II (G29, G 71) [ 31] (D) Nereis diversicolor sarcoplasmic Ca 21- binding protein (G 21, G55, N109, G143) [55,56] (E) Calerythrin (G22, G73, G 117 , G1 51) [50] ... calcium transport Biochemical identification of lysosomes containing calcium and calciumbinding protein (calbindin-D 28K ) J Biol Chem 2 61, 16 106 16 114 11 Fonseca, M & Soriano, E (19 95) Calretinin-immunoreactive ... respectively Fig 1H ,15 N HSQC of 15 N-labeled CR I –II with assignments Of note are residues G34 and G 81, the ‘position 6’ glycine residues Residues I36, E37, I83, E84 and M85 have 1H and 15 N chemical...
- 9
- 648
- 0
Báo cáo khoa học: Dual expression of mouse and rat VRL-1 in the dorsal root ganglion derived cell line F-11 and biochemical analysis of VRL-1 after heterologous expression pptx
... Graphical alignment of the open reading frames of rat VRL -1 (Acc No AF12 911 3) and mouse VRL -1 (Acc No NM_ 011 706) Rat and mouse VRL -1 cDNA share a homology of 92% The ORF length of rat VRL -1 is 2286 bp ... frames of rat VRL -1 (Acc No AF12 911 3) and mouse VRL -1 (Acc No NM_ 011 706) shows that rat and mouse VRL -1 share 92% sequence identity The ORF length of rat VRL -1 is 2286 bp whereas the mouse VRL -1 has ... that of F -11 and N18TG2 Ó FEBS 2003 Co-expression of mouse and rat VRL -1 in F -11 cells (Eur J Biochem 270) 4269 anti-VRL -1 polyclonal antibody gives only weak signals in the cytoplasm of F -11 cells...
- 8
- 439
- 0
Structural characterization and biochemical analysis of ID2, an inhibitor of DNA binding 1
... (14 ! 1. 6! ID(proteins (and( neurogenesis( . (14 ! 1. 7! IDs(in(cancer( (16 ! 1. 8! Properties (and( roles (of( ID2( (17 ! 1. 9! Aim (and( Scope (of( Project( ... purification of ID2 and ID3 mutants 10 3! Table 14 : ID1 & ID2 constructs and their theoretical biochemical properties estimated by ProtParam(Wilkins, et al., 19 99) 10 4! Table 15 : Changes ... Biggs, et al., 19 92, Christy, et al., 19 91, Riechmann, et al., 19 94, Sun, et al., 19 91) The mammalian family consisted of four members, namely ID1, ID2, ID3 and ID4 (Norton, 2000) and the human...
- 30
- 305
- 0
09 Physical and Chemical Characteristics of DDGS revisions.
... 14 -Apr-04 21- Apr-04 28-Apr-04 5-May-04 12 -May-04 19 -May-04 27-May-04 3-Jun-04 10 -Jun-04 10 11 12 9.05 10 .17 10 .65 10 .70 10 . 71 10.76 10 .93 11 .02 11 .28 11 .16 11 .70 11 .88 12 .13 12 .26 27.60 27. 61 27.59 ... Plants and Bulk Density of DDGS in 20 01 Plant 8a 8b 10 12 13 14 15 16 Average Particle Size Mean 13 98 13 22 14 25 13 70 12 55 612 974 12 58 11 42 13 37 14 88 12 35 11 98 12 29 212 5 11 48 12 82.25 Standard ... 0 .11 0 .13 0 .13 0.45 0.22 0 .14 0 .16 0 .13 0 .11 0 .14 0 .16 0 .17 0.07 0.20 0 .15 68% of the particles will fall between: 603 3243 6 61 2644 880 2309 745 25 21 747 210 8 223 16 83 453 2094 740 213 9 6 21 210 1...
- 8
- 748
- 0
Different physical and chemical pretreatments of wheat straw for enhanced biobutanol production in simultaneous saccharification and fermentation
... (Online) ©2 011 International Energy & Environment Foundation All rights reserved 626 [7] [8] [9] [10 ] [11 ] [12 ] [13 ] [14 ] [15 ] [16 ] [17 ] [18 ] [19 ] [20] International Journal of Energy and Environment ... pretreatment and SSF Qureshi et al., (6) biomass (g/L) 25.54 butanol (g/L) 2.70 total sugar (g/L) 10 .4 bacteria conc butanol yield (cells/L) % (g/g) 566 211 20 10 .55% 25.54 2.08 10 .4 311 416 20 8 .13 % 25.54 ... 2.08 10 .4 311 416 20 8 .13 % 25.54 2. 51 10.8 849 317 0 9.83% 25.54 2. 61 10.8 3397 211 0 10 .22% 86.00 7.00 25.92 - 8 .14 % Conclusions This study achieved its objective of producing optimum sugar concentrations...
- 12
- 376
- 0
Tài liệu PHYSICAL AND CHEMICAL ASPECTS OF ORGANIC ELECTRONIC doc
... Polarons and Polaron Pairs 333 Polarons, Bipolarons and Polaron Pairs 335 16 .3.2 16 .3.2 .1 16.3.2.2 16 .4 16 .4 .1 16.4.2 16 .5 16 .5 .1 16.5 .1. 1 16 .5 .1. 2 16 .5.2 Contents 16 .5.3 16 .6 16 .6 .1 16.6 .1. 1 16 .6 .1. 2 ... K Henkel, I Paloumpa, A Goryachko, and D Schmeißer 21. 1 21. 2 21. 2 .1 21. 2 .1. 1 21. 2 .1. 2 21. 2.2 21. 2.2 .1 21. 2.2.2 21. 3 21. 3 .1 21. 3 .1. 1 21. 3 .1. 2 21. 3.2 21. 3.2 .1 21. 3.2.2 Introduction 445 Experimental ... Realisation of an “Ideal” Diode-like Organic Electronic Device 226 Acknowledgement 228 References 229 11 .3 11 .4 11 .4 .1 11. 4.2 11 .4.3 11 .5 11 .6 11 .7 11 .8 12 Fundamental Interface Properties in OFETs:...
- 733
- 2,740
- 1
Tài liệu Báo cáo khoa học: Tissue expression and biochemical characterization of human 2-amino 3-carboxymuconate 6-semialdehyde decarboxylase, a key enzyme in tryptophan catabolism pptx
... Relative activity (%) – 1. 0 1. 0 0 .1 1.0 1. 0 0 .1 0 .1 1.0 0 .1 1.0 0.5 0.5 10 0 10 0 10 0 10 0 10 0 15 12 4 90 12 0 13 0 35 25 Fig Purification of recombinant human ACMSD I Tricine SDS ⁄ PAGE of fractions throughout ... compilation ª 2007 FEBS L Pucci et al 10 11 12 13 14 15 16 17 18 19 20 21 quinolinic acid immunoreactivity in Alzheimer’s disease hippocampus Neuropathol Appl Neurobiol 31, 395–404 Bosco MC, Rapisarda ... distinct bands between 10 00 and 11 00 bp of roughly the same extent (not shown) Cloning and nucleotide sequencing of these two products indicated that the lower band (10 11 bp) corresponded to the...
- 14
- 601
- 0
Tài liệu Báo cáo khoa học: Structural and biochemical characterization of a human adenovirus 2/12 penton base chimera pptx
... adenovirus ⁄ 12 penton base chimera C Zubieta et al 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 virus receptor is a transmembrane component of the tight junction Proc Natl Acad Sci USA 98, 15 1 91 15 196 ... 292.92 c ¼ 307.30 0.5° pentamers 363 715 12 4 622 19 .8–3.6 0.90 (0.92) 0 .13 (0.64) 4 .12 (1. 33) 2.9 15 -fold 15 .0–3.6 11 5 706 30 41 53 065 0.90 ⁄ 0.32 27.5 ⁄ 32.8 0. 015 1. 68 96.7% 3.3% (3) Values in parentheses ... FEBS 43 41 Human adenovirus ⁄ 12 penton base chimera C Zubieta et al and chimeric hAd2 ⁄ 12 pb were 1. 0 ± 0.3 lm and 1. 85 ± 0.7 lm, respectively (Fig 5B) During viral assembly, concentrations of the...
- 10
- 647
- 0
Báo cáo khoa học: Proteomic and biochemical analysis of 14-3-3-binding proteins during C2-ceramide-induced apoptosis pot
... 417 1 01 Histone H1.2a [1] 12 716 9 Myosin regulatory light chain 2a [1] 10 88 619 11 Titina [9] 49037474 CaMa,b [0] 17 17799 TSC2b,c [17 ] 747 512 16 B-cell scaffold protein with ankyrin repeats (BANK1)a ... A combined proteome and FEBS Journal 277 (2 010 ) 33 21 3342 ª 2 010 The Author Journal compilation ª 2 010 FEBS 3337 14 -3-3-binding status during apoptosis 10 11 12 13 14 15 16 M Pozuelo-Rubio ultrastructural ... distributions of 14 -3-3 sigma and 14 -3-3 zeta J Cell Sci 11 7, 14 11 14 20 70 Obenauer JC, Cantley LC & Yaffe MB (2003) Scansite 2.0: proteome-wide prediction of cell signaling 3340 71 72 73 74 75...
- 22
- 424
- 0
Báo cáo Y học: Purification and biochemical characterization of some of the properties of recombinant human kynureninase pptx
... 96 29 16 8.0 14 60 218 3 3505 310 8 2267 13 11 2.7 9.0 36.4 10 8 13 9 16 4 1. 00 3.30 13 .3 39.5 50.9 60.0 10 0 15 0 240 213 15 0 90 Ó FEBS 2002 Recombinant human kynureninase (Eur J Biochem 269) 20 71 tryptic ... frugiperda (Sf9) insect cells [11 ] Sf9 cells were grown at 28 °C in TC -10 0 suspension cultures of 10 L containing a minimal amount of fetal calf serum (1 2%) until 10 mL of growing cells resulted ... concentrations of substrate which becomes mixed (Ki¢ ¼ 55 lM) at higher levels of substrate in 10 mM Tris/HCl buffer at pH 7.9 and 37 °C, Km ¼ 3.0 lM, specific activity of 16 4 nmolÆmin )1 (mg protein) )1 and...
- 6
- 406
- 1
Báo cáo Y học: Structural and biochemical characterization of calhepatin, an S100-like calcium-binding protein from the liver of lungfish (Lepidosiren paradoxa) docx
... 98 10 3 Donato, R (19 99) Functional roles of S100 proteins, calciumbinding proteins of the EF-hand type Biochim Biophys Acta 14 50, 19 1–2 31 Kligman, D & Hilt, D.C (19 88) The S100 protein family ... determined are Ka1 ¼ (2.9 ± 0.3) · 10 5 M and Ka2 ¼ (6.0 ± 0.7) · 10 3 M (n ¼ 2 .1 ± 0.05) In the presence of mM Cu2+, binding constants are Ka1 ¼ (2.0 ± 0.3) · 10 5 M and Ka2 ¼ (4.6 ± 0.6) · 10 3 M (n ¼ ... Sci 13 , 437–443 Schafer, B.W & Heizmann, C.W (19 96) The S100 family of ¨ EF-hand calcium-binding proteins: functions and pathology Trends Biochem Sci 21, 13 4 14 0 Heizmann, C.W & Cox, J.A (19 98)...
- 9
- 445
- 0
Báo cáo khóa học: Identification of a gene encoding Lon protease from Brevibacillus thermoruber WR-249 and biochemical characterization of its thermostable recombinant enzyme pptx
... TTGACA 17 17 17 20 17 21 16 16 18 16 18 TTTG TTTG GTTG TATG TATG CTTG TGTG TNTG – TACAAT TACAAT TATAAT TAAAAT TACTAT TATAAT TAATTT TATAAT TATAAT + – – + – + + CIRCE – This work [10 ] [9] [ 61] [62] ... experiments and Northern blotting E coli JM109 [recA1 supE44 endA1 hsdR17 gyrA96 relA1 D(lac-proAB)-/F¢(traD36 proAB lacIq lacZDM15)], used in cloning experiments, and E coli BL 21 (DE3) [F– ompT ... J Bacteriol 17 6, 6 518 –6527 10 Ito, K., Udaka, S & Yamagata, H (19 92) Cloning, characterization, and inactivation of the Bacillus brevis lon gene J Bacteriol 17 4, 22 81 2287 11 Roudiak, S.G., Seth,...
- 11
- 505
- 0
Báo cáo khoa học: An a-proteobacterial type malate dehydrogenase may complement LDH function in Plasmodium falciparum Cloning and biochemical characterization of the enzyme potx
... 0.0 01 0.002 0.0 01 0.57 1. 350 ± 0.024 0 .15 2 ± 0. 013 0.370 ± 0. 019 kcat/Km (M )1 s )1) 960 950 10 10 674 32 26 45 0 .12 ± ± ± ± 68 79 15 0 35 250 ± 19 15 0 ± 20 17 5 ± 21 · · · · 10 6 10 6 10 6 10 6 0 .18 · 10 6 ... schizont 12 0 Gossypol 10 0 Enzyme activity remaining (%) 80 60 40 20 0 .1 120 10 10 0 10 00 Oxamate 10 0 80 60 40 20 10 10 0 10 00 10 000 Inhibitor Concentration (µM) µ Fig Inhibition of mammalian and Pf ... CALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGME -RKDLLKANVKIFKSQGA * :: : * **: * : 11 1 10 3 10 6 10 5 10 4 10 3 10 3 11 5 11 4 P falciparum (LDH) P falciparum (MDH) Rickettsia provazakii Rhizobium leguminosarum...
- 15
- 508
- 0
Báo cáo khoa học: Identification and biochemical characterization of the Anopheles gambiae 3-hydroxykynurenine transaminase pot
... 5653–5662 ª 2005 FEBS F Rossi et al 10 11 12 13 14 15 16 17 18 tion and mechanism of action of recombinant human kynurenine 3-hydroxylase Eur J Biochem 267, 10 92– 10 99 Han Q, Calvo E, Marinotti O, ... (lmolÆmin )1 mg )1) (lmolÆmin )1) (%) Lysate (soluble 594.4 fraction) Ammonium 272 sulfate precipitation HiTrap Q 10 9 Source Q 28 Mono Q 13 .4 10 .3 612 2.3 10 0 11 .7 318 2.4 52 17 .7 26.3 32.6 19 29.3 736.4 ... (lmolÆmin )1) kcat (min )1) kcat ⁄ Km (min )1 mM )1) D,L-3HK 2.0 2.3 1. 0 2.7 0.044 0.048 0.028 0 .10 2 988.5 10 77.2 611 .5 2264.8 494.3 468.3 611 .5 838.8 D,L-KYN L-KYN Glyoxylate ± ± ± ± 0.3 0.3 0.4 0 .1 FEBS...
- 10
- 421
- 1
Báo cáo Y học: Purification, crystallization, NMR spectroscopy and biochemical analyses of a-phycoerythrocyanin peptides pptx
... parentheses are minor components of the samples Peptides a-PEC Crystals of a-PEC Peptide 1A Peptide 1B Peptide 1C Peptide Peptide Molecular mass 18 15 1.6 18 18 15 (15 15 15 1.6 16 7.8 803.2 473.8) 585.0 ... groups J Am Chem Soc 10 9, 875–8 81 15 Hughes, J & Lamparter, T (19 99) Procaryotes and phytochrome The connection to chromophores and signaling Plant Physiol 12 1, 10 59 10 68 16 Neff, M.M., Fankhauser, ... different association states of the PEC complexes [11 ,12 , 21] The assembly of ‘monomeric’ and ‘trimeric’ complexes is accompanied by a decrease of the photochemistry from 10 0% of the isolated a-PEC to...
- 10
- 452
- 1
Báo cáo Y học: Agmatine oxidation by copper amine oxidase Biosynthesis and biochemical characterization of N-amidino-2-hydroxypyrrolidine pdf
... CaCl2, 1. 0 lgÆmL )1 calmodulin, 1. 0 · 10 )5 M FAD, 1. 0 · 10 )5 M FMN, [3H]L-arginine (from 12 to 18 5 kBq) and L-arginine (from 1. 0 · 10 )6 M to 1. 0 · 10 )4 M), in the absence and presence of N-amidino-2-hydroxypyrrolidine ... 0 .1) · 10 )5 (2 .1 ± 0 .1) · 10 )5 (8.9 ± 0.4) · 10 )5 a e Agmatine a a d (6.6 ± 1. 1) · 10 )4 (2.2 ± 0.2) · 10 )4 >10 )2 e Clonidine b b (5.0 ± 0.2) · 10 )3 >5 · 10 )2 c >10 )2 e c pH 7.5 and 37.0 °C Present ... (1) [13 ] Values of kcat and K for the NOS-I catalyzed conversion m of L-arginine to L-citrulline were 1. 4 ± 10 2 pmol prod )1 uctÆmin Æ(mg protein) )1 and 4.0 · 10 )6 M, respectively, at pH 7.5 and...
- 9
- 403
- 0
Báo cáo khóa học: Isolation and biochemical characterization of two soluble iron(III) reductases from Paracoccus denitrificans docx
... Fe(III)(DHB)3 10 0a 10 0a 12 5.5 3.8 91. 4 29.0 65.8 37.3 76.8 a 10 0% ¼ 2.04 · 10 )7 molÆs )1 mg protein )1; b 10 0b 82.3 10 0b 54.2 2.4 3.9 0.7 3.7 0 No enzyme +50 lM FMN FMNH2 10 0 69.0 10 0 54.9 1. 1 3 .1 0.7 ... Sepharose Q Polybuffer exchanger 96 Superose 12 HR 10 /30 25.5 2.8 2.8 4.0 517 .4 7. 81 0 .15 5 0.028 12 0.3 59 .1 15.9 9 .17 0.23 7.57 10 2.58 327.50 32.9 446 14 24 10 0 49 .13 13 .22 7.62 FerB Cytosolic extract Sepharose ... 8.4 0 10 0% ¼ 8.43 · 10 )9 molÆs )1 mg protein )1; c 10 0% ¼ 3.73 · 10 )5 – – 10 0c 10 6.4 5.5 83 .1 – 36.4 13 .0 28.0 )1 MÆs Ó FEBS 2004 the reduction of chromate by NADH, caused by the presence of FerB...
- 10
- 365
- 0
Báo cáo Y học: Molecular and biochemical characteristics of a gene encoding an alcohol acyl-transferase involved in the generation of aroma volatile esters during melon ripening pptx
... Sequence analysis Both CM-AAT1 and CM-AAT2 encode proteins of 4 61 amino acids with a theoretical molecular mass of 51. 5 kDa and 51. 8 and a pI of and 8.5, respectively, and 87% identity at the amino ... 10 32 865 17 60 + + NR NR NR NR NR NR NR NR NR NR NR + NR + TR 500 18 83 NT NT 14 34 10 00 NT NT 814 2050 19 60 13 93 935 390 19 15 + + NR NR NR + NR NR NR NR NR NR NR NR NR NR ±6 ± 21 ± 17 ± 69 ± 10 ± 73 ... 3-Met-2-buten -1- ol Linalol cis-2-Hexenol trans-2-Hexenol cis-3-Hexenol trans-3-Hexenol Benzyl alcohol 1- Phenyl ethanol 2-Phenyl ethanol TR 383 12 63 13 10 ND 916 796 610 ND 10 00 14 00 12 70 850 555 322 13 23...
- 8
- 509
- 0
EFFECT OF STORAGE TEMPERATURES ON THE PHYSIOLOGICAL AND BIOCHEMICAL PROPERTIES OF HYLOCEREUS POLYRHIZUS
... Microwave Drying 8 10 11 12 12 13 13 14 15 15 17 19 20 20 21 22 23 2.6 Effect of Extraction Methods on Antioxidant Activity of Herbs 2.6 .1 Effect of Extraction Solvents 2.6.2 Effect of Extraction ... Chemistry 10 1: 14 17 -14 24 EI Nahhal, Y 2004 Contamination and Safety Status of Plant and Food in Arab Countries Journal of. Ap;Ff:d Science 4(3): 411 - 417 EI-Magoli, S.B., Karel, M & Yong, S 19 79 Acceleration ... of Food Composition and Analysis 18 (2-3) :19 3 -19 9 Gunhan, T., Demir, V., Hancioglu, E & Hepbasli, A 2005 Mathematical Modeling of Drying Bay Leaves Energy Conversion and Management 46 (11 -12 ) :16 67 -16 79...
- 40
- 571
- 2
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25