Nghiên cứu xác định một số gen của tôm sú penaeus monodon sử dụng phương pháp phân tích thư viện cdna est

BỘ GIÁO DỤC VÀ ĐÀO TẠO VIỆN HÀN LÂM KHOA HỌC VÀ CÔNG NGHỆ VIỆT NAM VIỆN SINH THÁI VÀ TÀI NGUYÊN SINH VẬT TRẦN TRUNG THÀNH NGHIÊN CỨU XÁC ĐỊNH MỘT SỐ GEN CỦA TÔM SÚ (PENAEUS MONODON) SỬ DỤNG PHƢƠNG PHÁP PHÂN TÍCH THƢ VIỆN cDNA/EST Chuyên ngành: Mã số: Sinh học thực nghiệm 60 42 01 14 TÓM TẮT LUẬN VĂN THẠC SỸ SINH HỌC NGƢỜI HƢỚNG DẪN KHOA HỌC TS KIM THỊ PHƢƠNG OANH Hà Nội - 12/2013 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ LỜI CẢM ƠN Trước tiên, tơi xin bày tỏ lịng biết ơn sâu sắc tới TS Kim Thị Phương Oanh, Trưởng phịng Hệ gen học Mơi trường, Viện Nghiên cứu hệ gen, tận tình hướng dẫn dìu dắt tơi suốt thời gian qua Tôi xin cảm ơn tới PGS TS Nơng Văn Hải, Trưởng phịng Hệ gen học người, Viện trưởng Viện Nghiên cứu hệ gen, tạo điều kiện để tơi hồn thành khóa luận Trong q trình thực đề tài, tơi nhận bảo chun mơn nhiệt tình cán nghiên cứu Viện Nghiên cứu hệ gen, Viện Hàn Lâm Khoa học Công nghệ Việt Nam Tơi xin bày tỏ lịng biết ơn sâu sắc tới giúp đỡ q báu Cuối cùng, xin gửi lời cảm ơn đến người thân gia đình bạn bè động viên giúp đỡ suốt thời gian học tập làm việc vừa qua Xin chân thành cảm ơn! Hà Nội, ngày tháng năm 2013 Trần Trung Thành Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ LỜI CAM ĐOAN Tôi xin cam đoan số liệu kết nghiên cứu luận văn trung thực không trùng lặp với đề tài khác Tôi xin cam đoan rằng, giúp đỡ việc thực đề tài đƣợc cảm ơn thơng tin trích dẫn luận văn đƣợc ghi rõ nguồn gốc Ký tên Trần Trung Thành Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ MỤC LỤC MỤC LỤC I DANH MỤC CHỮ VIẾT TẮT III DANH MỤC CÁC HÌNH IV DANH MỤC CÁC BẢNG V MỞ ĐẦU .1 CHƢƠNG I: TỔNG QUAN TÀI LIỆU .3 1.1 ĐẶC ĐIỂM SINH HỌC CỦA TÔM SÚ 1.1.1 Vị trí phân loại phân bố .3 1.1.2 Đặc điểm sinh học 1.1.2.1 Đặc điểm sinh trƣởng sinh sản .3 1.1.2.2 Chu kỳ sống .3 1.1.2.3 Tập tính dinh dƣỡng 1.1.2.4 Điều kiện môi trƣờng sống 1.2 TÌNH HÌNH NI TRỒNG TƠM SÚ TRÊN THẾ GIỚI VÀ .6 VIỆT NAM 1.2.1 Diện tích, sản lƣợng tôm giới Việt Nam 1.2.2 Giá trị kinh tế tôm sú 1.2.3 Những thách thức nghề nuôi trồng tôm sú 1.2.3.1 Vấn đề dịch bệnh .9 1.2.3.2 Vấn đề chọn giống 11 1.2.3.3 Gia hóa tơm sú .13 1.3 CÔNG NGHỆ SINH HỌC TRONG NUÔI TRỒNG TÔM SÚ 17 1.3.1 Chẩn đoán kiểm soát dịch bệnh 17 1.3.2 Phát triển thị phân tử 19 1.3.3 Nghiên cứu chức gen liên quan tới số tính trạng quan trọng 27 1.4 XU HƢỚNG PHÁT TRIỂN VÀ TRIỂN VỌNG CỦA CÔNG NGHỆ SINH HỌC TRONG NUÔI TRỒNG TÔM SÚ .33 CHƢƠNG II VẬT LIỆU VÀ PHƢƠNG PHÁP .35 2.1 VẬT LIỆU 35 2.1.1 Thu thập mẫu 35 2.1.2 Hóa chất 35 2.1.3 Thiết bị 36 2.2 PHƢƠNG PHÁP 37 2.2.1 Tách chiết RNA tôm sú 39 2.2.2 Tinh mRNA 40 2.2.3 Tạo thƣ viện cDNA/EST tôm sú từ mô sử dụng plasmid vector với vị trí tái tổ hợp đặc hiệu .43 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 2.2.3.1 Tổng hợp cDNA có chứa trình tự attB1 attB2 (DNA recombination sites) hai đầu .43 2.2.3.2 Phân đoạn cDNA theo kích thƣớc 46 2.2.3.3 Tinh cDNA 48 2.2.3.4 Đƣa cDNA vào vector (pDONR222) phản ứng tái tổ hợp điểm attB attP 49 2.2.3.5 Biến nạp vector vào tế bào vi khuẩn .51 2.2.3.6 Kiểm tra thƣ viện cDNA/EST phản ứng cắt enzyme giới hạn………………………………………………………………………… 52 2.2.4 Xác định trình tự cDNA/EST 54 2.2.5 Phƣơng pháp phân tích liệu trình tự 55 CHƢƠNG III KẾT QUẢ VÀ THẢO LUẬN 57 3.1 TÁCH CHIẾT RNA TỔNG SỐ TÔM SÚ 57 3.2 TẠO THƢ VIỆN CDNA/ EST 58 3.3 KIỂM TRA THƢ VIỆN CDNA/ EST BẰNG PHẢN ỨNG CẮT ENZYME GIỚI HẠN .59 3.3.1 Tách chiết plasmid tái tổ hợp 59 3.3.2 Cắt plasmid tái tổ hợp enzyme giới hạn 60 3.3.3 Số liệu thống kê thƣ viện cDNA/EST tôm sú tạo lập 62 3.4 GIẢI MÃ CÁC CDNA/EST TỪ CÁC THƢ VIỆN ĐÃ TẠO LẬP 63 KẾT LUẬN VÀ KIẾN NGHỊ 80 TÀI LIỆU THAM KHẢO .81 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ DANH MỤC CHỮ VIẾT TẮT aa AFLP AHPNS ddNTPs DEPC DNA dNTPs DO EDTA EMS EST EtBr GAS GAV HPV IHHNV IMNV LAMP Mab MAS MBV MCS mtDNA OD ORF Pab PCR pH QTL RACE RAPD RFLP RNA RT-PCR SNP WSSV YHV amino acid Amplified Fragment Length Polymorphism (Đa hình chiều dài đoạn DNA) Acute Hepatopancreatic Necrosis Syndrome Dideoxyribonucleoside triphosphate (ddATP, ddCTP, ddGTP, ddTTP) Diethyl pyrocarbonate Deoxyribonucleic acid Deoxyribonucleoside triphosphate (dATP, dCTP, dGTP, dTTP) Dissolve oxygen Ethylenediaminetetraacetic acid Early Mortality Syndrome Expressed sequence tag (Đoạn trình tự gen biểu hiện) Ethidium bromide Gene Assisted Selection Gill associated virus Hepatopanceatic parvovirus Infectious hypodermal and haematopoietic necrosis virus Infectiuos meonecrosis virus Loop-mediated isothermal amplification Monoclonal antibodies Marker Assisted Selection Monodon baculovirus Multiple cloning site (Vùng cắt gắn đa vị vector) Mitochondrial DNA (DNA ty thể) Optical Density (Mật độ quang học) Open Reading Frame (Khung đọc mở ) Polyclonal antibodies Polymerase Chain Reaction (Phản ứng chuỗi polymerase) Potential hydrogen Quantitative trait locus Rapid Amplification of cDNA Ends (khuếch đại đầu 5„ 3„ cDNA) Random Amplification of Polymorphic DNA (Đa hình đoạn DNA đƣợc nhân ngẫu nhiên) Restriction Fragment Length Polymorphism (Đa hình chiều dài đoạn DNA cắt enzyme giới hạn) Ribonucleic acid Reverse transcriptase-PCR (PCR enzyme phiên mã ngƣợc) Single-nucleotide polymorphism (Đa hình nucleotide đơn) White spot syndrome virus (virus gây bệnh đốm trắng) Yellow head virus (virus gây bệnh đầu vàng) Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ DANH MỤC CÁC HÌNH Chƣơng I Hình 1 Chu kỳ sống tôm Chƣơng II Hình Sơ đồ quy trình tạo ngân hàng cDNA tơm sử dụng plasmid vector với vị trí tái tổ hợp đặc hiệu…………………………………………………………… 38 Hình 2 Dụng cụ nghiền mẫu (Homogenizer)………………………………… 39 Hình Sơ đồ nguyên lý trình tinh mRNA từ RNA tổng số………… 41 Hình Sơ đồ nguyên lý trình tổng hợp cDNA……………………… 43 Hình Đánh dấu đĩa thạch agarose 1% dùng để xác định nồng độ cDNA…… 48 Hình Bản đồ vector pDONR222…………………………………………… 50 Hình Nguyên lý trình đƣa cDNA vào vector pDONR222………… 50 Hình Sơ đồ phân tích liệu trình tự nucleotide cDNA/EST……………… 56 Chƣơng III Hình Điện di đồ mẫu RNA tổng số tách chiết từ mô khác 57 Hình Kết biến nạp vector tái tổ hợp vào tế bào vi khuẩn 59 Hình 3 Master plate 59 Hình Một số hình ảnh điện di kiểm tra plasmid tái tổ hợp tác từ dòng tế bào thƣ viện cDNA/EST tôm sú 60 Hình Điện di đồ kiểm tra kích thƣớc cDNA đƣợc đƣa vào vector pDONR222 .61 Hình Thống kê thành phần phân loại trình tự cDNA/EST 75 Hình So sánh (alignment) trình tự amino acid protein antimicrobial peptide tôm sú Việt Nam với trình tự cơng bố 76 Hình So sánh (alignment) trình tự nucleotide gen hemocyanin tôm sú Việt Nam với trình tự cơng bố .77 Hình So sánh (alignment) trình tự amino acid protein hemocyanin tơm sú Việt Nam với trình tự cơng bố .78 Hình 10 So sánh (alignment) trình tự amino acid protein c-type lectin tôm sú Việt Nam với trình tự cơng bố 79 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ DANH MỤC CÁC BẢNG Chƣơng I Bảng 1 Một số chƣơng trình gia hóa tơm sú giới [63] 16 Chƣơng III Bảng Các mẫu mô tôm sú sử dụng nghiên cứu .57 Bảng Kết kiểm tra nồng độ số mẫu RNA tổng số phƣơng pháp đo quang phổ (độ pha loãng 100 lần) 58 Bảng 3 Bảng thống kê số lƣợng dịng tế bào phân tích thƣ viện cDNA/.EST từ mẫu mô tôm sú 62 Bảng Bảng phân tích kết tìm kiếm trình tự tƣơng đồng protein suy diễn (Kết BLASTP) 64 Bảng Bảng phân tích kết tìm kiếm trình tự tƣơng đồng các trình tự EST (Kết BLASTN) 70 Bảng Chú giải chức protein theo GO 73 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ MỞ ĐẦU Tôm sú (Penaeus monodon) thuộc giống Penaeus, họ Penaeidae lồi có đặc điểm sinh trƣởng nhanh, đƣợc nuôi rộng rãi giới Nghề nuôi tôm mạnh thuỷ sản, chuyên gia ngành thủy sản đánh giá, tôm sú đối tƣợng xuất chủ lực nƣớc ta Duy trì ổn định nghề ni tơm phụ thuộc nhiều vào nguồn tôm khỏe mạnh kiểm soát dịch bệnh hiệu Cho đến nay, nhiều nghiên cứu đƣợc tiến hành Tuy nhiên, việc chọn tạo giống tơm sú cịn nhiều khó khăn, nguồn tôm giống chủ yếu đánh bắt tự nhiên Nền tảng cho chƣơng trình chọn giống nghiên cứu gen hệ gen Nghiên cứu hệ gen cung cấp thông tin di truyền gen liên quan đến tính trạng sinh trƣởng, sinh sản, kháng bệnh chống chịu với điều kiện tự nhiên Có nhiều phƣơng pháp nhằm tiếp cận nghiên cứu hệ gen tơm sú đó, phƣơng pháp phân lập phân tích đoạn trình tự gen biểu (Expressed Sequence Tag, EST) phƣơng pháp sinh học phân tử đại nhằm tập trung nghiên cứu gen chức Trong năm gần đây, nghiên cứu cDNA/EST tôm sú đạt đƣợc số kết góp phần làm sáng tỏ số chế phân tử liên quan đến sinh trƣởng, sức sinh sản khả kháng bệnh Để tạo tiền đề cho nghiên cứu genome tôm sú, xây dựng đề tài nghiên cứu: “ Nghiên cứu xác định số gen tôm sú (Penaeus monodon) sử dụng phương pháp phân tích thư viện cDNA/EST” Nghiên cứu đƣợc thực nhờ hỗ trợ kinh phí từ đề tài “Nghiên cứu giải trình tự phần gen xây dựng sở liệu genome tôm sú (P.monodon)” thuộc chƣơng trình “Phát triển Ứng dụng Cơng nghệ sinh học ngành Thủy sản”, Bộ Nông nghiệp Phát triển nông thôn Mục tiêu nghiên cứu: - Xây dựng thƣ viện cDNA/EST tôm sú tự nhiên/nuôi Việt Nam - Xác định trình tự cDNA/EST - Chú giải chức số gen thu thập đƣợc từ thƣ viện cDNA/EST Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ hemocyanin: gen hemocyanin tôm thẻ chân trắng đƣợc phát có nhiều SNP [138] tƣợng alternative splicing [137] C-type lectin aa C-type lectin P monodon 10 20 30 40 50 60 | | | | | | | | | | | | TALFSVAAS ASVRATDCPSPYE MLTHLAIFALVAVSISGQPLQGRSQKTELLVAVGILEEQVQDVKQKVIALPNSGALCPYP C-type lectin aa C-type lectin P monodon 70 80 90 100 110 120 | | | | | | | | | | | | PLDETRCIFVDAYVAYTWQDTVDLCKTHGGEILTIEDCETFALVYDYIRSQDVTKGKHYW YKQVLDECFYLSKVKLNWNQARQYCQGMQGDLATPRN VYALKSFVIDT AAEVTEAW C-type lectin aa C-type lectin P monodon 130 140 150 160 170 180 | | | | | | | | | | | | LGATDEVEEGTWKYVNNRPIPMGVPFWAKNEPN-SGNTYNCAIMHASNNYYWYDIPCGNK LGATDQSSEGTWNWLDGRPVAS -DWAGGQPDDAGGNEDCLDLRTKWHPTLNDYQCGVA C-type lectin aa C-type lectin P monodon | YNPICLKNY QHFVCQYNA Hình 10 So sánh (alignment) trình tự amino acid protein c-type lectin tơm sú Việt Nam với trình tự cơng bố Đối với gen c-type lectin, từ kết so sánh trình tự amino acid (alignment) protein c-type lectin với trình tự protein c-type lectin tơm sú công bố ngân hàng gen quốc tế (mã số: AAZ29608), thấy xuất nhiều vị trí có sai khác (Hình 3.10) Điều cho thấy, trình tự protein suy diễn thu đƣợc, tƣơng đồng cao với c-type lectin nhƣ Bảng 3.4 Tuy nhiên, trình tự hồn tồn mới, khơng tƣơng đồng với trình tự cơng bố tôm sú (P monodon) Kết phù hợp với nghiên cứu họ gen C-type lectin (protein đóng vai trị quan trọng hệ thống miễn dịch tôm sú) Siêu họ lectin chia 13 họ lectin có C-type lectin, Họ gen lectin chia họ gen phụ theo cấu trúc tƣơng đồng chức khác chúng, tức có nhiều gen mã hóa cho nhiều loại c-type lectin khác [105] Số lƣợng trình tự thu đƣợc chƣa nhiều để tìm quy luật biểu gen cá thể tôm trạng thái không bị bệnh mắc bệnh đốm trắng loại mô khác Do đó, mở rộng số lƣợng mẫu nhƣ Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ hồn thiện quy trình xây dựng thƣ viện hƣớng đề tài này, nhằm mở rộng liệu thƣ viện đƣa giả thuyết biểu gen KẾT LUẬN VÀ KIẾN NGHỊ KẾT LUẬN Chúng thiết lập thƣ viện cDNA/ EST (mô cơ, mô gan tụy, mô gốc mắt) đối tƣợng tôm sú khỏe mạnh tôm sú nhiễm bệnh đốm trắng Tổng số có 1630 dịng tái tổ hợp đƣợc phân tích (884 dịng mơ cơ, 400 dịng mơ gan tụy, 345 dịng mơ gốc mắt), có 383 dịng có chứa đoạn chèn lớn 300 bp 1247 dịng có chứa đoạn chèn nhỏ 300 bp Trên tổng số 253 loại trình tự phân tích xác định đƣợc 24 trình tự protein giải chức năng, 143 trình tự “hypothetical protein” (trong có 44 “hypothetical protein” mới) 86 trình tự EST/ 3‟-UTR (trong có 79 trình tự EST/ 3‟-UTR mới) Trong số 24 protein giải đƣợc chức năng, có 19 protein phát tôm sú (P monodon) Đặc biệt, phƣơng pháp phân tích thƣ viện cDNA/ EST, gen quan trọng liên quan tới hệ miễn dịch tôm sú đƣợc phân lập, xác định trình tự, giải chức năng: zinc proteinase, pyruvate kinase, hemocyanin, c-type lectin, putative antimicrobial peptide Trong đó, xác định đƣợc SNP (325 [G-A], 389 [T-G], 397 [G-C], 399 [C-A]) xuất gen hemocyanin KIẾN NGHỊ Các kết nghiên cứu đề tài bƣớc đầu, số lƣợng trình tự cDNA/ EST giải mã đƣợc cịn so với chƣơng trình giải mã gen tƣơng tự giới Do vậy: - Cần tối ƣu quy trình xây dựng thƣ viện cDNA/ EST nhằm thu đƣợc thƣ viện cDNA/ EST chất lƣợng cao Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ - Xây dựng quy trình tạo thƣ viện cDNA/ EST phƣơng pháp hiệu nhƣ sử dụng phage lambda vector - Tiếp cận công nghệ giải mã gen máy giải trình tự hệ (next generation sequencing) Hƣớng nghiên cứu đề tài cần đƣợc đầu tƣ mở rộng hơn, hƣớng tới giải mã tồn hệ gen phiên mã (transcriptome) tơm sú TÀI LIỆU THAM KHẢO TÀI LIỆU TIẾNG VIỆT 10 11 Chuyên đề phân tích ngành (2008), "Ngành Thủy sản phát triển, hội thách thức & ứng dụng mô hình APT phân tích rủi ro ngành", Trường Đại học Kinh tế - TP Hồ Chí Minh Hồ Thị Bích Ngân, Hồng Tùng, Ðào Văn Trí (2005), "Thử nghiệm nuôi phát dục tôm sú (Penaeus monodon Fabricius, 1798) bố mẹ thức ăn chế biến", Thông tin KHCN & Kinh tế thủy sản, 10 Lê Long Triều (2008), "Khảo sát tình hình ni tơm sú (Penaeus monodon) thâm canh xã An Đức Vĩnh An, huyện Ba Tri, tỉnh Bến Tre (LVTN kỹ sƣ, Khoa Thủy sản)", Trường Đại học Nơng Lâm - TP Hồ Chí Minh Lê Ngơ Hồi Bảo, Lê Chí Tâm, Sản xuất giống tơm sú, phẩm Khoa kỹ thuật Nông nghiệp công nghệ thực, Editor 2011, Trƣờng Đại học Tiền Giang Nguyễn Minh Thành, Raul W Ponzoni, Nguyễn Hồng Nguyên, Nguyễn Thanh Vũ, Andrew Barnesc, Peter B Matherd (2010), "Nâng cao chất lƣợng giống tôm xanh (macrobrachium rosenbergii): Phƣơng pháp lai hay phƣơng pháp chọn lọc? ", Tạp chí Khoa học, 107-117 Nguyễn Thanh Phƣơng, Trần Ngọc Hải (2009), Giáo trình Kỹ thuật sản xuất giống nuôi giáp xác, Khoa Thủy sản - Trƣờng Đại học Cần Thơ Nguyễn Văn Chung (2000), Cơ sở sinh học kỹ thuật sản xuất giống nhân tạo tôm sú, Nhà xuất Nông nghiệp, TP Hồ Chí Minh Nguyễn Văn Hảo (2000), "Một số vấn đề kỹ thuật nuôi tôm sú công nghiệp", Nhà xuất Nơng nghiệp - TP Hồ Chí Minh Phạm Văn Tình (2003), Kỹ thuật ni tơm sú thâm canh, Nhà xuất Nơng nghiệp - TP Hồ Chí Minh Quyền Đình Thi, Đào Thị Tuyết, Lê Thị Thu Giang, Nguyễn Thị Thảo, Phạm Anh Tuấn (2003), "Sử dụng microsattelite, mtRFLP RAPD để phân tích đa hình tơm sú (Penaeus monodon)", Tạp chí Cơng nghệ sinh học, 1(3), 287-298 Trần Việt Tiên, Đặng Thị Hoàng Oanh (2009), "Phát triển quy trình mPCR phát đồng thời white spot syndrome virus, infectious hypodermal and haematopoietic necrosis virus tôm sú (Penaeus monodon) sử dụng gen β-actin làm nội chuẩn", Kỷ yếu Hội Nghị Khoa Học Thủy Sản Toàn Quốc năm 2009, 197 - 201 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 12 13 14 15 Trần Việt Tiên, Trần Thị Mỹ Duyên, Đặng Thị Hoàng Oanh (2008), "Phát triển quy trình mRT-PCR phát GAV (Gill-associated virus) beta-actin", Tạp chí Khoa học, 1, 176180 Trung Tâm Khuyến Ngƣ Trung Ƣơng (2000), Kỹ Thuật nuôi tôm sú thương phẩm, Nhà Xuất Nông nghiệp VASEP (2012), "Báo cáo Ngành tôm Việt Nam năm 2012, xu hƣớng năm 2013", Hội chế biến xuất thủy sản Việt Nam Vũ Thế Trụ (2003), Thiết lập điều hành trại sản xuất tôm sú giống Việt Nam, Nhà xuất Nơng nghiệp TP Hồ Chí Minh TÀI LIỆU TIẾNG ANH 16 17 18 19 20 21 22 23 24 25 Alejandra C Z., Eugenia G C R., Hugo H M., Gabriel R C M., Alfonso M ı O., H
e C J a (2013), "Genetic parameters for spawning and growth traits in the Pacific white shrimp (Penaeus (Litopenaeus) vannamei)", Aquaculture Research, 1-7 Altschul S F., Gish W., Miller W., Myers E W., Lipman D J (1990), "Basic local alignment search tool", Journal Molecular Biology, 215(3), 403-10 Amparyup P., Kondo H., Hirono I., Aoki T., Tassanakajon A (2008), "Molecular cloning, genomic organization and recombinant expression of a crustin-like antimicrobial peptide from black tiger shrimp Penaeus monodon", Molecular Immunology, 45(4), 1085-93 Arif I A., Khan H A (2009), "Molecular markers for biodiversity analysis of wildlife animals: a brief review", Animal Biodiversity and Conservation, 32(1), 9-17 Bangrak P., Graidist P., Chotigeat W., Supamattaya K., Phongdara A (2002), "A synteninlike protein with postsynaptic density protein (PDZ) domains produced by black tiger shrimp Penaeus monodon in response to white spot syndrome virus infection", Diseases of Aquatic Organisms, 49(1), 19-25 Baskaralingam Vaseeharan, Perumal Rajakamaran, David Jayaseelan, Anita Yeshvadha Vincent (2013), "Molecular markers and their application in genetic diversity of penaeid shrimp", Aquaculture International, 21(2), 219-241 Benzie J A., Ballment E., Forbes A T., Demetriades N T., Sugama K., Haryanti, Moria S (2002), "Mitochondrial DNA variation in Indo-Pacific populations of the giant tiger prawn, Penaeus monodon", Molecular Ecology, 11(12), 2553-69 Benzie J A H., Ballment E., Frusher S (1993), "Genetic structure of Penaeus monodon in Australia: preliminary data from the allozymes and mtDNA", Aquaculture, 111, 89-93 Bishop S., Chesnais J., Stear M.J (2002), Breeding for disease resistance: issues and opportunities, Proceeding 7th World Congress on Genetics Applied to Livestock Production, Communication 13-01, , Montpellier, 597-604 Chantanachookin C., Boonyaratpalin S., Kasoranchandra J., Direkbusarakom S., Aekpanithanpong U (1993), "Histology and ultrastructure reveal a new granulosis-like virus in Penaeus monodon affected by yellow-head disease", Diseases of Aquatic Organisms, 17, 145-157 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 Chapman R.W., Craig L.B., Suzanne S., Sarah P., Wenner E (2004), "Sampling and evaluation of white spot syndrome virus in commercially important Atlantic penaeid shrimp stocks", Diseases of Aquatic Organisms, 59, 179-85 Chu-Fang Lo J, Chiann-Horng Leu, Ching-Hui Hol, Chau-Huei Chenl, Shao-En Pengl, You-Tzung Chenl, Chih-Ming choul, Pei-Yan Yehl, Chang-Jenuang, Hsin-Yiu chou, Chung-Hsiung wang, Kou Guang-Hsiung (1996), "Detection of baculovirus associated with white spot syndrome (WSBV) in penaeid shrimps using polymerase chain reaction", Diseases of Aquatic Organisms, 25, 133-141 Chu K H., Li C P., Tam Y K., Lavery S (2003), "Application of mitochondrial control region in population genetic studies of shrimp Penaeus", Molecular Ecology Notes, 3, 120122 Coman G.J., Arnold S.J., Jones M.J., Preston N.P (2007), "Effect of rearing density during maturation on growth, survival and reproductive performance of domesticated Penaeus monodon", Aquaculture, 264, 175-183 Dang Thi Hoang Oanh, Truong Quoc Phu, Nguyen Thanh Phuong, Pham Anh Tuan (2013), "Ongoing Vietnam studies find Vibrio with phage transmits EMS/ AHPNS", Global Aquaculture Advocate, (4), 22-23 Du Z Q., Onteru S K., Gorbach D., Rothschild M.F., A SNP Genetic Map for Pacific White Shrimp (Litopenaeus vannamei), in Animal Industry Report: AS 656, ASL R2514 2010 Edgerton B.F (2004), "Susceptibility of the Australian freshwater crayfish Cherax destructor albidus to white spot syndrome virus (WSSV)", Diseases of Aquatic Organisms, 59, 187-93 Escobedo Bonilla C.M., Alday-Sanz V., Wille M., Sorgeloos P., Pensaert M.B (2008), "A review on the morphology, molecular characterization, morphogenesis and pathogenesis of white spot syndrome virus", Journal of Fish Diseases, 31, - 18 Fanning A S., Anderson J M (1996), "Protein-protein interactions: PDZ domain networks", Current Biology, 6(11), 1385-8 FAO (2012), "State of World Fisheries and Aquaculture, Food and Agricultural Organization of the United Nations" FAO (2011), "State of World Fisheries and Aquaculture, Food and Agricultural Organization of the United Nations" FAO (2002), "State of World Fisheries and Aquaculture, Food and Agricultural Organization of the United Nations" Gael L , Emmerik M., Virna Cede X S., John M.C M., Benoit D., Eric M (2013), shrimp disease prevention and genetic selection programs for resistance against pathogens in south america: strategy, results and perspectives, World Aquaculture Society Meetings Aquaculture 2013 Nashville, Tennessee, USA Grootjans J J., Zimmermann P., Reekmans G., Smets A., Degeest G., Durr J., David G (1997), "Syntenin, a PDZ protein that binds syndecan cytoplasmic domains", Proceeding of the National Academy of Sciences U S A, 94(25), 13683-8 Gross P S., Bartlett T C., Browdy C L., Chapman R W., Warr G W (2001), "Immune gene discovery by expressed sequence tag analysis of hemocytes and hepatopancreas in the Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 41 42 43 44 45 46 47 48 49 50 51 52 53 Pacific White Shrimp, Litopenaeus vannamei, and the Atlantic White Shrimp, L setiferus", Developmental & Comparative Immunology, 25(7), 565-77 Gudkovs N., Pradeep B., Stalin Raj V., Slater J., Sittidilokratna N., Mohan C.V., Walker P.J (2007), Application of PCR for improved shrimp health management in the Asian region, FRDC aquatic animal health subprogram scientific conference, Cairns Gueguen Y., Garnier J., Robert L., Lefranc M P., Mougenot I., de Lorgeril J., Janech M., Gross P S., Warr G W., Cuthbertson B., Barracco M A., Bulet P., Aumelas A., Yang Y., Bo D., Xiang J., Tassanakajon A., Piquemal D., Bachere E (2006), "PenBase, the shrimp antimicrobial peptide penaeidin database: sequence-based classification and recommended nomenclature", Developmental & Comparative Immunology, 30(3), 283-8 James A B (2013), "Hawaiian Company Breeds SPF Black Tiger Shrimp For Improved Growth", Global Aquaculture Advocate, (Sec1), 78-79 James C., Thomas G., Marcela S., Morten R (2009), "Breeding for disease resistance of Penaeid shrimps", Aquaculture, 286, 1-11 JoL R., Ana C G (2013), Shrimp breeding program issues from brazil: wssv resistance, new theories on disease resistance, subversion of the classical spf concept, World Aquaculture Society Meetings - Aquaculture 2013 Nashville, Tennessee, USA Jorge Cuéllar-Anjel, Mathias Corteel, Leonardo Galli, Victoria Alday-Sanz, Kenneth W Hasson (2012), "From the Shrimp Book: Principal shrimp infectious diseases, diagnosis and management", Global Aquaculture Advocate, (3), 14-15 Kallaya Sritunyalucksana, Jiraporn Srisala, Kenneth McColl, Linda Nielsen, Timothy W Flegel (2006), "Comparison of PCR testing methods for white spot syndrome virus (WSSV) infections in penaeid shrimp", Aquaculture, 255, 95-104 Karunasagar I., Otta S.K (1997), "Histopathological and bacteriological study of white spot syndorme of Penaeus monodon along the west coat of India", Aquaculture, 153, 9-13 Klinbunga S., Penman D J., McAndrew B J., Tassanakajon A (1999), "Mitochondrial DNA Diversity in Three Populations of the Giant Tiger Shrimp Penaeus monodon", Marine Biotechnology (NY), 1(2), 113-121 Klinbunga S., Siludjai D., Wudthijinda W., Tassanakajon A., Jarayabhand P., Menasveta P (2001), "Genetic heterogeneity of the giant tiger shrimp (Penaeus monodon) in Thailand revealed by RAPD and mitochondrial DNA RFLP analyses", Marine Biotechnology (NY), 3(5), 428-38 Kuntal M., Nripendranath M (2009), "A Microsatellite DNA Marker Developed for Identifying Disease-resistant Population of Giant Black Tiger Shrimp, Penaeus monodon", Journal of the World Aquaculture Society, 40(2), 274-280 Lavery S., Chan T Y., Tam Y K., Chu K H (2004), "Phylogenetic relationships and evolutionary history of the shrimp genus Penaeus s.l derived from mitochondrial DNA", Molecular Phylogenetic Evolution, 31(1), 39-49 Li A L., Li H Y., Jin B F., Ye Q N., Zhou T., Yu X D., Pan X., Man J H., He K., Yu M., Hu M R., Wang J., Yang S C., Shen B F., Zhang X M (2004), "A novel eIF5A complex functions as a regulator of p53 and p53-dependent apoptosis", The Journal of Biological Chemistry, 279(47), 49251-8 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 Lightner D.V (2005), "Biosecurity in shrimp farming: pathogen exclusion through use of SPF stock and routine surveillance", Journal of the World Aquaculture Society, 36, 229248 Liu C., Wang X., Xiang J., Li F (2012), "EST-derived SNP discovery and selective pressure analysis in Pacific white shrimp (Litopenaeus vannamei)", Chinese Journal of Oceanology and Limnology, 30(5), 713-723 Liu Z.J., Cordes J.F (2004), "DNA marker technologies and their applications in aquaculture genetics", Aquaculture, 238, 1-37 Loc Tran, Linda Nunan, Rita M Redman, Donald V Lightner, Fitzsimmons Kevin (2013), "EMS/ AHPNS: Infectious disease cause by bacteria ", Global Aquaculture Advocate, (4), 18-19 Lu J.K., Hsiao Y.T., Wu J.L (2011), "Applications of shrimp immune DNA microarray in aquaculture", Diseases in Asian Aquaculture VII Fish Health Section, Bondad-Reantaso M.G., Jones J.B., Corsin F.,Aoki T., Asian Fisheries Society, Selangor, Malaysia., 241252 McIntosh R.P (1999), "Changing paradigms in shrimp farming: General description", Global Aquaculture Advocate, 2, 40-47 Michał G., Walter D G., Kenneth C S (2004), "A novel polymorphic mtDNA marker for population studies of the pink shrimp, Farfantepenaeus duorarum (Crustacea, Penaeidae)", Oceanologia, 46(1), 147-151 Moss S.M (1999), "Biosecure shrimp production: emerging technologies for a maturing industry", Global Aquaculture Advocate, 2, 50-52 Nelzo E (2007), "Introduction to genome annotation", Retrieved, from http://mcclintock.generationcp.org/index.php?option=com_content&task=view&id=45&It emid=64 Nguyen Duy Hoa (2009), Domestication of black tiger shrimp (Penaeus monodon) in recirculation systems in Vietnam, Ghent University, Belgium Nigel P., Greg C (2009), "Black Tiger Shrimp Domestication Advances Biosecure Production, Genetic Markers Assist Development", Global Aquaculture Advocate, 64-65 Nigel P., Greg C., Jeff C., Nick M., Brian M (2010), "Black Tiger Breeding Program Yields Record Shrimp Harvests In Australia", Global Aquaculture Advocate Nigel P P (2013), The interface between R&D providers and the shrimp industry: opportunities, challenges and solutions in domestication and selective breeding of penaeus monodon, World Aquaculture Society Meetings - Aquaculture 2013 Nashville, Tennessee, USA Noel H., Brian M (2006), "Success for black tiger prawn domestication", Retrieved 15/12, 2006, from http://www.austasiaaquaculture.com.au/blog/success-for-black-tiger-prawndomestication.html Norris A.T., Bradley D.G., Cunningham E.P (2000), "Parentage and relatedness determination in farmed Atlantic salmon (Salmo salar) using microsatellite markers", Aquaculture, 182, 73- 83 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 69 70 71 72 73 74 75 76 77 78 79 80 81 Notomi T., Okayama H., Masubuchi H., Yonekawa T., Watanabe K., Amino N., Hase T (2000), "Loop-mediated isothermal amplification of DNA", Nucleic Acids Research, 28(e63) Nunan L.M., Poulos B.T., Lightner D.V (2000), "Use of polymerase chain reaction (PCR) for the detection of infectious hypodermal and hematopoietic necrosis virus (IHHNV) in penaeid shrimp", Marine Biotechnology, 2, 319-328 Paisarn Khawsak, Warin Deesukon, Parin Chaivisuthangkura, Wasana Sukhumsirichart (2008), "Multiplex RT-PCR assay for simultaneous detection of six viruses of penaeid shrimp", Molecular and Cellular Probes, 22, 177-183 Pongsomboona S., Whanb V., Mooreb S.S., Tassanakajona A (2000), "Characterization of Tri- and Tetranucleotide Microsatellites in the Black Tiger Prawn, Penaeus monodon", ScienceAsia, 26 1-8 Poulos B.T., Lightner D.V (2006), "Detection of infectious myonecrosis virus (IMNV) of penaeid shrimp by reverse-transcriptase polymerase chain reaction (RT-PCR)", Diseases of Aquatic Organisms, 73, 69-72 Preechaphol R , Klinbunga S , Khamnamtong B , Menasveta P (2010), "Isolation and characterization of genes functionally involved in ovarian development of the giant tiger shrimp Penaeus monodon by suppression subtractive hybridization (SSH)", Genetics and Molecular Biology, 33(4), 676-685 Priyanjalie K.M., Wijegoonawardane, Jeff A Cowley, Peter J Walker (2010), "A consensus real-time RT-PCR for detection of all genotypic variants of yellow head virus of penaeid shrimp", Journal of Virological Methods, 167, 5-9 Reyes A., Salazar M., Granja C (2007), "Temperature modifies gene expression in subcuticular epithelial cells of white spot syndrome virus-infected Litopenaeus vannamei", Developmental & Comparative Immunology, 31, 23-29 Rezvani G S., Safari R., Laloei F., Taqavi J., Matinfar A (2011), "Using RAPD markers potential to identify heritability for growth in Fenneropenaeus indicus", Iranian Journal of Fisheries Sciences, 10(1), 123-134 Robalino J., Chapman R W., Vega de la E., O'Leary N A., Gorbach D M., Du Zhi-Qiang, Rothschild M F., Browdy C L., Warr G W., Labreuche Y (2012), "Advances in Genomics and Genetics of Penaeid Shrimp", Aquaculture Biotechnology, FletcherG L., Rise M L.,Wiley-Blackwell, Oxford, UK Shekhar M.S., Azad I.S., Ravichandran P (2006), "Comparison of dot blot and PCR diagnostic techniques for detection of white spot syndrome virus in different tissues of Penaeus monodon", Aquaculture, 261, 1122-7 Sithigorngul W., Rukpratanporn S., Pecharaburanin N., Longyant S., Chaivisuthangkura P., Sithigorngul P (2006), "A simple and rapid immunochromatographic test strip for detection of white spot syndrome virus (WSSV) of shrimp", Diseases of Aquatic Organisms, 72, 101-106 Sritunyalucksana K., Srisala J., Mccoll K., Nielsen L., Flegel T.W (2006), "Comparison of PCR testing methods for white spot syndrome virus (WSSV) infections in penaeid shrimp ", Aquaculture, 255, 95-104 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 82 83 84 85 86 87 88 89 90 91 92 93 94 95 Sritunyalucksana K., Wannapapho W., Lo C F., Flegel T W (2006), "PmRab7 is a VP28binding protein involved in white spot syndrome virus infection in shrimp", The Journal of Virology, 80(21), 10734-42 Staelens J., Rombaut D., Vercauteren I., Argue B., Benzie J., Vuylsteke M (2008), "Highdensity linkage maps and sex-linked markers for the black tiger shrimp (Penaeus monodon)", Genetics, 179, 917-925 Supungul P., Klinbunga S., Pichyangkura R., Hirono I., Aoki T., Tassanakajon A (2004), "Antimicrobial peptides discovered in the black tiger shrimp Penaeus monodon using the EST approach", Diseases of Aquatic Organisms, 61(1-2), 123-35 Supungul P., Klinbunga S., Pichyangkura R., Jitrapakdee S., Hirono I., Aoki T., Tassanakajon A (2002), "Identification of immune-related genes in hemocytes of black tiger shrimp (Penaeus monodon)", Marine Biotechnology (NY), 4(5), 487-94 Tabassum J., Suman L (2006), "Single nucleotide polymorphism (SNP) - Method and applications in plant genetics: A review", Indian Journal of Virology, 5, 435-495 Tassanakajon A., Klinbunga S., Paunglarp N., Rimphanitchayakit V., Udomkit A., Jitrapakdee S., Sritunyalucksana K., Phongdara A., Pongsomboon S., Supungul P., Tang S., Kuphanumart K., Pichyangkura R., Lursinsap C (2006), "Penaeus monodon gene discovery project: the generation of an EST collection and establishment of a database", Gene, 384, 104-12 Tharntada S., Ponprateep S., Somboonwiwat K., Liu H., Soderhall I., Soderhall K., Tassanakajon A (2009), "Role of anti-lipopolysaccharide factor from the black tiger shrimp, Penaeus monodon, in protection from white spot syndrome virus infection", Journal of General Virology, 90(Pt 6), 1491-8 Tiu Hiu Kwan (2007), Vitellogenesis and vitellogenin receptor in shrimp: from the sites of synthesis to the final storage in the ovary, The University of Hong Kong Tong J., Lehnert S.A., Byrne K., Kwan H.S., Chu K.H (2002), "Development of polymorphic EST markers in Penaeus monodon: applications in penaeid genetics", Aquaculture, 208 69- 79 Tong J G., Chan T Y., Chu K H (2000), "A preliminary phylogenetic analysis of Metapenaeopsis (Decapoda: Penaeidae) based on mitochondrial DNA sequences of selected species from the Indo-West Pacific", Journal of Crustacean Biology, 20, 543-551 Tonganunt M., Nupan B., Saengsakda M., Suklour S., Wanna W., Senapin S., Chotigeat W., Phongdara A (2008), "The role of Pm-fortilin in protecting shrimp from white spot syndrome virus (WSSV) infection", Fish Shellfish Immunology, 25(5), 633-7 Tonganunt M., Phongdara A., Chotigeat W., Fujise K (2005), "Identification and characterization of syntenin binding protein in the black tiger shrimp Penaeus monodon", Journal of Biotechnology, 120(2), 135-45 Wang Q., Nunan L.M., Lightner D.V (2000), " Identification of genomic variations among geographic isolates of white spot syndrome virus using restriction analysis and southern blot hybridization", Diseases of Aquatic Organisms, 43, 175-81 Wilson K., Li Y., Whan V., S L., Byrne K., Moore S., Pongsomboon S., Tassanakajon A., Rosenberg G., Ballment E., Fayazia Z., Swana J., Kenwaya M., J B (2002), "Genetic Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 96 97 98 99 100 101 102 103 104 105 106 107 108 mapping of the black tiger shrimp Penaeus monodon with amplified fragment length polymorphism", Aquaculture, 204(3-4), 185-519 Wilson K., Cahill V., Ballment E., Benzie J (2000), "The complete sequence of the mitochondrial genome of the crustacean Penaeus monodon: are malacostracan crustaceans more closely related to insects than to branchiopods?", Molecular Biology Evolution, 17(6), 863-74 Withyachumnarnkul B., Boonsaeng V., Flegel T.W P S., Wongteerasupaya C (1998), "Domestication and selective breeding of Penaeus monodon in Thailand", Advances in shrimp biotechnology , Flegel T.W., National Center for Genetic Engineering and Biotechnology, Bangkok Wongteerasupaya C., Boonsaeng V., Panyim S., Tassanakajon A., Withyachumnarnkul B (1997), "Detection of yellow-head virus (YHV) of Penaeus monodon by RT-PCR amplification", Diseases of Aquatic Organisms, 31, 181-186 You E M., Chiu T S., Liu K F., Tassanakajon A., Klinbunga S., Triwitayakorn K., de la Pena L D., Li Y., Yu H T (2008), "Microsatellite and mitochondrial haplotype diversity reveals population differentiation in the tiger shrimp (Penaeus monodon) in the IndoPacific region", Animal Genetics, 39(3), 267-77 Yu M Y C., Rothschild M (2006), "SNP analysis of molting related genes in Penaeus monodon and Litopenaeus vannamei shrimp", Arch Tierz Dummerstorf 49(4), 411-412 Zeng D., Chen X., Peng Y Li M., Jiang N Ma W., Yang C., Li M (2008), "Analysis of Hsp70 in Litopenaeus vannamei and detection of SNPs", Journal of Crustacean Biology, 28(4), 727-730 Zhang L., Yang C., Zhang Y., Li L., Zhang X., Zhang Q (2007), "A genetic map of Pacific white shrimp (Litopenaeus vannamei): sex-linked microsatellite markers and high recombination rates", Genetics, 131, 37-49 Wang Z Z., Jiao C Z., Zhang X J., Xiang J H (2003), "Molecular cloning and sequence analysis of full length cDNA encoding molt-inhibiting hormone from Fennropenaeus chinensis", Yi Chuan Xue Bao, 30(2), 128-34 Adachi K., Endo H., Watanabe T., Nishioka T., Hirata T (2005), "Hemocyanin in the exoskeleton of crustaceans: enzymatic properties and immunolocalization", Pigment Cell Research, 18(2), 136-43 Cambi A., Figdor C G (2003), "Dual function of C-type lectin-like receptors in the immune system", Current Opinion in Cell Biology, 15(5), 539-46 Chimini G., Chavrier P (2000), "Function of Rho family proteins in actin dynamics during phagocytosis and engulfment", Nature Cell Biology, 2(10), E191-6 Chubb J R., Wilkins A., Thomas G M., Insall R H (2000), "The Dictyostelium RasS protein is required for macropinocytosis, phagocytosis and the control of cell movement", Journal of Cell Science, 113 ( Pt 4), 709-19 De Vos S., Bossier P., Van Stappen G., Vercauteren I., Sorgeloos P., Vuylsteke M (2013), "A first AFLP-based genetic linkage map for brine shrimp Artemia franciscana and its application in mapping the sex locus", PLoS One, 8(3), e57585 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 109 110 111 112 113 114 115 116 117 118 119 120 121 Decker H., Jaenicke E (2004), "Recent findings on phenoloxidase activity and antimicrobial activity of hemocyanins", Developmental & Comparative Immunology, 28(78), 673-87 Destoumieux-Garzon D., Saulnier D., Garnier J., Jouffrey C., Bulet P., Bachere E (2001), "Crustacean immunity Antifungal peptides are generated from the C terminus of shrimp hemocyanin in response to microbial challenge", The Journal of Biological Chemistry, 276(50), 47070-7 Garcia D K., Faggart M A., Rhoades L., Alcivar-Warren A A., Wyban J A., Carr W H., Sweeney J N., Ebert K M (1994), "Genetic diversity of cultured Penaeus vannamei shrimp using three molecular genetic techniques", Molecular Marine Biology and Biotechnology, 3(5), 270-80 Glenn K L., Grapes L., Suwanasopee T., Harris D L., Li Y., Wilson K., Rothschild M F (2005), "SNP analysis of AMY2 and CTSL genes in Litopenaeus vannamei and Penaeus monodon shrimp", Animal Genetics, 36(3), 235-6 Gorbach D M., Hu Z L., Du Z Q., Rothschild M F (2010), "Mining ESTs to determine the usefulness of SNPs across shrimp species", Animal Biotechnology, 21(2), 100-3 Han F., Zhang X (2007), "Characterization of a ras-related nuclear protein (Ran protein) up-regulated in shrimp antiviral immunity", Fish Shellfish Immunol, 23(5), 937-44 Hetzer M., Gruss O J., Mattaj I W (2002), "The Ran GTPase as a marker of chromosome position in spindle formation and nuclear envelope assembly", Nature Cell Biology, 4(7), E177-84 Hulata G (2001), "Genetic manipulations in aquaculture: a review of stock improvement by classical and modern technologies", Genetics, 111(1-3), 155-73 Ji P., Liu G., Xu J., Wang X., Li J., Zhao Z., Zhang X., Zhang Y., Xu P., Sun X (2012), "Characterization of common carp transcriptome: sequencing, de novo assembly, annotation and comparative genomics", PLoS One, 7(4), e35152 Khamnamtong B., Thumrungtanakit S., Klinbunga S., Aoki T., Hirono I., Menasveta P (2006), "Identification of sex-specific expression markers in the giant tiger shrimp (Penaeus monodon)", Journal of biochemistry and molecular biology, 39(1), 37-45 Lei K., Li F., Zhang M., Yang H., Luo T., Xu X (2008), "Difference between hemocyanin subunits from shrimp Penaeus japonicus in anti-WSSV defense", Developmental & Comparative Immunology, 32(7), 808-13 Lorenzi H A., Hoover J., Inman J., Safford T., Murphy S., Kagan L., Williamson S J (2011), "TheViral MetaGenome Annotation Pipeline(VMGAP):an automated tool for the functional annotation of viral Metagenomic shotgun sequencing data", Standards in Genomic Sciences, 4(3), 418-29 Maneeruttanarungroj C., Pongsomboon S., Wuthisuthimethavee S., Klinbunga S., Wilson K J., Swan J., Li Y., Whan V., Chu K H., Li C P., Tong J., Glenn K., Rothschild M., Jerry D., Tassanakajon A (2006), "Development of polymorphic expressed sequence tagderived microsatellites for the extension of the genetic linkage map of the black tiger shrimp (Penaeus monodon)", Animal Genetics, 37(4), 363-8 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 122 123 124 125 126 127 128 129 130 131 132 133 134 135 Meehan D., Xu Z., Zuniga G., Alcivar-Warren A (2003), "High frequency and large number of polymorphic microsatellites in cultured shrimp, Penaeus (Litopenaeus) vannamei [Crustacea:Decapoda]", Marine Biotechnology, 5(4), 311-30 Nagai T., Osaki T., Kawabata S (2001), "Functional conversion of hemocyanin to phenoloxidase by horseshoe crab antimicrobial peptides", The Journal of Biological Chemistry, 276(29), 27166-70 Nevo R., Stroh C., Kienberger F., Kaftan D., Brumfeld V., Elbaum M., Reich Z., Hinterdorfer P (2003), "A molecular switch between alternative conformational states in the complex of Ran and importin beta1", Nature Structure Biology, 10(7), 553-7 Pan D., He N., Yang Z., Liu H., Xu X (2005), "Differential gene expression profile in hepatopancreas of WSSV-resistant shrimp (Penaeus japonicus) by suppression subtractive hybridization", Developmental & Comparative Immunology, 29(2), 103-12 Perkel J M (2009), "Shrimp study exposes mechanisms of innate immunity", Journal of Proteome Research, 8(3), 1107 Pradeep B., Rai P., Mohan S A., Shekhar M S., Karunasagar I (2012), "Biology, Host Range, Pathogenesis and Diagnosis of White spot syndrome virus", Indian Journal of Virology, 23(2), 161-74 Sarathi M., Simon M C., Venkatesan C., Hameed A S (2008), "Oral administration of bacterially expressed VP28dsRNA to protect Penaeus monodon from white spot syndrome virus", Marine Biotechnology, 10(3), 242-9 Shekhar M S., Lu Y (2009), "Application of nucleic-acid-based therapeutics for viral infections in shrimp aquaculture", Marine Biotechnology, 11(1), 1-9 Tassanakajon A., Klinbunga S., Paunglarp N., Rimphanitchayakit V., Udomkit A., Jitrapakdee S., Sritunyalucksana K., Phongdara A., Pongsomboon S., Supungul P., Tang S., Kuphanumart K., Pichyangkura R., Lursinsap C (2006), "Penaeus monodon gene discovery project: the generation of an EST collection and establishment of a database", Genetics, 384, 104-12 Tiu S H., Benzie J., Chan S M (2008), "From hepatopancreas to ovary: molecular characterization of a shrimp vitellogenin receptor involved in the processing of vitellogenin", Biology of Reproduction, 79(1), 66-74 Ventura T., Aflalo E D., Weil S., Kashkush K., Sagi A (2011), "Isolation and characterization of a female-specific DNA marker in the giant freshwater prawn Macrobrachium rosenbergii", Heredity (Edinb), 107(5), 456-61 Vincent J., Dai Z., Ravel C., Choulet F., Mouzeyar S., Bouzidi M F., Agier M., Martre P (2013), "dbWFA: a web-based database for functional annotation of Triticum aestivum transcripts", Database (Oxford), 2013, bat014 Xu Z., Dhar A K., Wyrzykowski J., Alcivar-Warren A (1999), "Identification of abundant and informative microsatellites from shrimp (Penaeus monodon) genome", Animal Genetics, 30(2), 150-6 Zhang X., Huang C., Qin Q (2004), "Antiviral properties of hemocyanin isolated from shrimp Penaeus monodon", Antiviral Research, 61(2), 93-9 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ 136 137 138 Zhang Y., Wang S., Xu A., Chen J., Lin B., Peng X (2006), "Affinity proteomic approach for identification of an IgA-like protein in Litopenaeus vannamei and study on its agglutination characterization", Journal of Proteome Research, 5(4), 815-21 Zhao S., Lu X., Zhang Y., Zhao X., Zhong M., Li S., Lun J (2013), "Identification of a novel alternative splicing variant of hemocyanin from shrimp Litopenaeus vannamei", Immunology Letters, 154(1-2), 1-6 Zhao X., Guo L., Zhang Y., Liu Y., Zhang X., Lun J., Chen J., Li Y (2012), "SNPs of hemocyanin C-terminal fragment in shrimp Litopenaeus vannamei", FEBS Letters, 586(4), 403-10 Số hóa Trung tâm Học liệu http://www.lrc-tnu.edu.vn/ DANH MỤC CÁC CÔNG TRÌNH KHOA HỌC LIÊN QUAN ĐẾN LUẬN VĂN Kim Thị Phƣơng Oanh, Trần Trung Thành, Nguyễn Đăng Tôn, Vũ Hải Chi, Huỳnh Thị Thu Huệ, Trần Thị Ngọc Diệp, Lê Thị Thu Hiền, Nguyễn Hữu Ninh, Phạm Anh Tuấn, Nơng Văn Hải (2010) Giải mã phần trình tự cDNA/EST xây dựng sở liệu genome tôm sú (Panaeus monodon) Hội nghị Công nghệ sinh học Thuỷ sản Toàn quốc Kim Thị Phƣơng Oanh, Trần Trung Thành, Nguyễn Đăng Tôn, Vũ Hải Chi, Huỳnh Thị Thu Huệ, Nguyễn Hữu Ninh, Phạm Anh Tuấn, Nông Văn Hả (Panaenus monodon 406 - 415 PHỤ LỤC ... tiền đề cho nghiên cứu genome tôm sú, xây dựng đề tài nghiên cứu: “ Nghiên cứu xác định số gen tôm sú (Penaeus monodon) sử dụng phương pháp phân tích thư viện cDNA/ EST? ?? Nghiên cứu đƣợc thực nhờ hỗ... nông thôn Mục tiêu nghiên cứu: - Xây dựng thƣ viện cDNA/ EST tôm sú tự nhiên/nuôi Việt Nam - Xác định trình tự cDNA/ EST - Chú giải chức số gen thu thập đƣợc từ thƣ viện cDNA/ EST Số hóa Trung tâm... phƣơng pháp nhằm tiếp cận nghiên cứu hệ gen tơm sú đó, phƣơng pháp phân lập phân tích đoạn trình tự gen biểu (Expressed Sequence Tag, EST) phƣơng pháp sinh học phân tử đại nhằm tập trung nghiên cứu