... rescues insulin receptor and IRS-1 from TNFα –suppressed phosphorylation (Peraldi and Spiegelman, 1997), and inhibits TNFα-induced lipolysis (Souza et al., 1998) by repressing TNFα expression in ... isoforms share the same response element D domain contains the nuclear targeting signal and also serves as a hinge region between C and E domains E domain constitutes the globular ligand-binding ... SDS-PAGE SDS-polyacrylamide gel electrophoresis Ser Serine SERM Selective estrogen receptor modulators shRNA Short-hairpin RNA siRNA small interfering RNA SMRT Silencing mediator for retinoid and...
... create cysteine (Anderson and Luo, 1998) Cells utilize cysteine to synthesize GSH, which can be oxidized to form GSSG, thus protecting other proteins from oxidative stress Besides being a cycteine ... The ROS levels were assessed using CM-H2DCFDA fluorescence by flow cytometry as described in Materials and Methods 3A3.2 ONOO– is the main RNS species produced by PPARγ ligands in breast cancer ... PPARγ ligands and the effect of these ROS/RNS species on NHE1 expression 3A3.1 Production of ROS/RNS by PPARγ ligands in breast cancer cells First, we wanted to assess whether PPARγ ligands produce...
... to investigate the ability of ERα to bind to its response element in regular and CS FBS The in vitro binding of ERα to classical ERE was assessed using Noshift Transcription Factor assay as described ... ERα status To further test whether ER-negative breast cancer cells stably expressing ERα receptor regains its hormonal responsiveness, we used a MDA-MB-231 ER+ cells line which was stably transfected ... Transcription Factor Assay was utilized for determination of endogenous ERα binding to classical ERE as described in Materials and Methods Results denote means +/-SD computed from two experiments...
... effects of atorvastatin against ischemia-reperfusion injury." Cardiovasc Res 65(2): 345355 Biswas, D K., S Singh, et al (2005) "Crossroads of estrogen receptor and NF-kappaB signaling." Sci STKE ... affects the binding to ERα to its response element on chromosome of MCF-7 cells, we performed ChIP assay using both PPARγ and ERα antibodies and assessed the binding of each reaceptor at various sites ... functions as a H+ pump to remove excess protons from cells (Orlowski and Grinstein, 2004) Studies have shown that acquiring alkaline pHi is a fundamental step in transformed cells (Reshkin et al.,...
... colony forming assay was performed as described in Materials and Methods Similar to what we observed in MCF-7, 15d-PGJ2 resulted in a dose-dependent 111 reduction in the number as well as the size ... days of incubation, cells were stained with crystal violet Images of scanned plates are shown Graphical representation of colony counts from colony forming assays Results denote means +/-SD computed ... ligands To further accertain that the colonogenic inhibition by 15d-PGJ2 is common inother PPARγ expressing breast cancer cell lines, MDA-MB-231 and T47D cells were also subjected to 1µM and...
... binding of ERα to classical ERE and putative NHE1 ERE in both regular and CS serum conditions was assessed using Noshift Transcription Factor assay as described in the Materials and Methods It ... achieve this, we assessed the in vitro andin vivo binding of PPARγ to NHE1 promoter, using Noshift Transcription Factor assay and ChIP assay in MCF-7 cells The cells were exposed to 15d-PGJ2 for ... endogenous level of NHE1 and ERα were first assessed in normal MDAMB-231 cells and MDA-MB-231 cells stably transfected with ERα (MDA-MB231 ER positive cells) using Western blot The successful re-expression...
... Sea Route 231 For Russia, ships must satisfy special crewing and training requirements for navigating in ice.56 For the USA, requirements as to manning, training, qualifications and watchkeeping ... application to state vessels as well as the high seas.93 Application of the Russian regime seems even less plausible in the case of submarines, to which the NSR Regulations regarding leading in ice would ... Vil’kitskii Straits incidents of the mid-196 0s, which involved US Coast Guard and Navy vessels navigating in the Laptev, East Siberian and Kara Seas; the straits themselves were not entered.123 In these...
... MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHT -MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHT -MLVHTYSAME -RPDGLG-AAAGGARLSSLPQAAYGPAPPLCHT -MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYS ... Epsilon Delta IPINKDNLFGGV-VNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGG LMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGG LPCQKE LVGAVMNPTEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGG ... repressors By regulating target genes with AP-2-binding sites within their promoter sequences, the AP-2 transcription factors play important roles in cellular processes, such as morphogenesis, in...
... a-actinin-2 ()) Bundling proteins Coactivator Supervillin NLS F-actin- and membraneassociated scaffolding protein Filamin NLS? Cross-linking proteins Filamin A NLS? Cross-linking proteins Transgelin ... -3, as STARS-interacting proteins These novel proteins contain four LIM domains and a C-terminal villin headpiece domain, which mediates actin-binding in several proteins, such as villin and dematin ... were shown to serve as a link between STARS and SRF In NIH 3T3 cells cotransfected with expression plasmids encoding MRTFs and STARS, the MRTFs are translocated to the nucleus in the absence of serum...
... promoters of caspase-1, caspase-8 and caspase-10, and increase their expressions In turn, increased pro-caspase-8 is recruited to HIPPI–HIP-1 heterodimer and increases apoptosis The role of caspase-1 ... domain of HIP-1 interacts with 3-phosphate containing inositol lipids and stabilizes the growth factor receptor tyrosine kinases by increasing their half-life following ligand induced endocytosis ... highly self-associative, resulting in aggregates ⁄ neuronal intranuclear inclusions Aggregates ⁄ neuronal intranuclear inclusions are observed in cell models, brains of transgenic animals, and post-mortem...
... glucose (lanes and 3) or in synthetic complete medium containing glucose (lanes and 5) Extracts were subjected to Western blot analysis as described in Materials and methods Lane represents the ... impairs GAL gene induction This observation is consistent with: (a) that disruption of MRG19 does not interfere in the constitutive expression of GAL genes in a gal80 strain (see Results); and ... over-expression of Mrg19p could sequester Gal80p–Gal4p complex thereby decreasing galactokinase expression Consistent with this idea, over-expression of MRG19 does not suppress the constitutive expression...
... available in the rheumatology clinic and will be discussed later in this manuscript In brief, tissue was cut into small pieces and digested in medium containing 0.15 mg/ml DNAse type I (Sigma) and ... [17] and of macrophages [18] and to antagonise inflammatory mediators such as histamine, prostaglandin E2, leukotrienes, and neurokinins [19] The mechanism by which VIP antagonises LPS-induced ... analysis Comparison of data was assessed using GraphPad Prism version 3.0 (GraphPad Software Inc, San Diego, CA, USA) Statistical differences were determined with Student s t-test Differences were regarded...
... Orthopedic/Plastic Surgery Department of Charing Cross Hospital, London, UK Tissue was teased into small pieces and digested in medium containing 0.15 mg/ml DNAase type I (Sigma, Gillingham, Dorset, UK) and ... cellular contact, including anti-CD3 cross-linking with or without anti-CD28 stimulation (as used in this study) [34], cytokines such as IL-2, IL-6 and TNFα (as used in this study) [19] or IL-15 ... production in the presence of these inhibitors [23] As the promoters of all the chemokines studied here contain NFκB binding sites, this raises the obvious question of how this effect is regulated...
... function of germline versus embryonic transcript synthesis In contrast, cross-species comparisons allow studying this force and understanding the factors that affect it These show that this selective ... data and refer to the maternal and zygotic gene classes as strict-maternal and strict-zygotic By necessity, the maternal-zygotic class is less precisely defined and includes slowly decaying strict-maternal ... gene sets provide a means to normalize length for cross-species comparisons Performing this comparative analysis between maternal and zygotic gene classes separates the studied animals into two...
... Huntington sDisease W.B Saunders London, 1996 Ross CA: Polyglutamine pathogenesis: emergence of unifying mechanisms for Huntington sdiseaseand related disorders Neuron 2002, 35(5):819-822 Behrens PF, ... analysis, and interpretation SJB performed statistical analyses and genotyping, and helped with data interpretation BRM participated in study design, and helped with data collection and analysis ... ceftriaxone-induced increase in glutamate uptake since ceftriaxone acts selectively on GLT1 [12] It also is unlikely that loss of other glutamate transporters can account for the decline in uptake since...
... test was used to compare continuous variables The alpha level for statistical significance was set at p < 0.05 Analyses were performed using SPSS Statistics 15.0 Results DFP suppresses neutrophil ... was calibrated against a standard curve and was represented in μM Statistical Analysis Results are reported as the mean ± standard deviation, unless otherwise noted The paired Student s t test ... DFP alters caspase-3 and caspase-8 processing and activity Caspases are synthesized as pro-enzymes that are cleaved at conserved tetra-or pentapeptide amino acid sequences adjacent to aspartic...
... test was used to compare continuous variables The alpha level for statistical significance was set at p < 0.05 Analyses were performed using SPSS Statistics 15.0 Results DFP suppresses neutrophil ... was calibrated against a standard curve and was represented in μM Statistical Analysis Results are reported as the mean ± standard deviation, unless otherwise noted The paired Student s t test ... DFP alters caspase-3 and caspase-8 processing and activity Caspases are synthesized as pro-enzymes that are cleaved at conserved tetra-or pentapeptide amino acid sequences adjacent to aspartic...
... factors and a variety of cellular stress signals [97] Inhibition of either enzyme in hepatocytes using specific inhibitors prevented PP-induced increase in S- phase [98], suggesting a role of MAP kinase ... expressed in white and brown adipose tissue, large intestine and spleen [43,44] In contrast to PPARα and PPARγ, which are abundantly expressed in just a few tissues, PPARβ is expressed in virtually ... transmission of extracellular signals, resulting in the direct or indirect phosphorylation of transcription factors and subsequent alterations in gene expression [96] The MEK (MAP kinase kinase)...