reduction oxidation and molecular ions of 3 3´ bi 2 r 5 5 dimethy 1 4 oxopyrrolinylidene 1 1´ dioxides
bài giảng toán 3 chương 2 bài 5 tìm 1 trong các phần bằng nhau của 1 số
... 1/ 6 30 là: 30 : = (30 số đó, là số phần) 2. Luyện tập: Bài 1: Viết số thích hợp vào chỗ chấm? a 1 /2 kg ……………… kg (hoặc 1 /2 kg là: kg) b 1/ 4 24 lít …………… 24 : = l c 1 /5 35 m ………………7m 35 : = d 1/ 6 ... số kẹo là: 12 : 3= ( ) Đáp số: kẹo Nếu chị cho em 1/ 4 số kẹo em Nếu chị cho em 1 /2 số kẹo em 12 kẹo kẹo mấy 12 ::kẹo ?3 mấy 12 = cái = kẹo? 1. Bài toán: Chị có 12 kẹo, chị cho em 1 /3 số kẹo Hỏi ... 1 /3 số kẹo ? kẹo 12 kẹo 1. Bài toán: Chị có 12 kẹo, chị cho em 1 /3 số kẹo Hỏi chị cho em kẹo? Nhận xét: - Chia 12 kẹo thành phần - Mỗi phần 1 /3 số kẹo ? kẹo Bài giải: Chị cho em số kẹo là: 12 ...
- 11
- 1,132
- 1
Cytophysiologic effects and molecular inhibition of a functional actin specific ADP ribosyltransferase CDT from clostridium difficile 3
... SK 1 25 2 SK 12 2 8 SK1 23 6 SK 12 4 2 Ia C2 C3 CT PT LT VIP2 29 8 29 8 29 8 29 8 29 8 29 8 29 1 29 5 84 34 5 LTVYRRSGP LTVNRRSGP LTVPRRSGP LTVYPRSGP LTVYRRSGP LTVYRRSGP LIVYRRSGP LIAYRRVDG IILFRGDDP KLYRADSR TVYRYDSR ... Temecula1 2. E- 01 68% GS10 12 9 Toxin B Clostridium difficile 1. E- 23 10 0% AF 21 729 2 GS 41 34 8 Toxin A locus CDTOXA, X 517 9, AA1 -1 42 Clostridium difficile 2. E -10 10 0% CAA360 93 TcdE locus CDI 01 13 0 1, AJ 01 13 0 1 ... 5. E- 05 53 % AAF9 13 8 8 GS1 04 39 8 Toxin B Clostridium difficile 1. E -59 10 0% AF 21 729 2 GS 110 12 7 Tox protein DT -20 1 Corynebacterium diphtheriae 2. E-06 10 0% AAA 726 20 GS 12 8 18 7 S-layer protein Clostridium...
- 52
- 186
- 0
Spectral stability study and molecular modeling of fluorence based conjugated polymers 3
... 44 6, 4 31 630 62 PDHFDHP 940 0 1 . 54 32 4 3. 25 40 9 53 3 58 PDHFDMOP 27 700 1. 78 37 2 2. 92 4 25 (44 8) 58 0 52 PDHFDHOP 50 500 2. 00 37 3 2. 91 4 25 (44 8) 57 5 49 PDHFDDOP 41 4 00 2. 08 37 2 2. 92 4 25 56 0 46 Polymers ... parameters of the polymers 1 .37 λmax, Abs (nm) 37 9 Band Gap (eV) 2. 88 λmax, Em (nm) 4 52 , 42 0 (48 0, 52 0 ) λOnset, Em (nm) 610 FWHM (nm) 62 >11 600 2. 90 37 9 2. 88 4 51 58 5 39 PDHFP 11 800 1. 70 37 1 2. 92 44 6, ... and/ or molecular chain packaging Spectral features caused by aggregation ,37 -40 exciplexes , 25 , 41 excimers ,22 - 25 , 34 , 42 , 43 and energy transfer5,6 ,44 , 45 have been demonstrated in conjugated polymers...
- 29
- 400
- 0
Báo cáo khoa học: Correlation between conformational stability of the ternary enzyme–substrate complex and domain closure of 3-phosphoglycerate kinase potx
... MgADP 3- PG 3- PG + MgADP 12 9 16 0 20 4 17 4 24 1 32 9 41 8 55 1 45 7 658 31 .0 35 .1 39 .6 37 .3 44 .9 12 8 13 7 12 7 12 2 1 32 33 3 35 9 32 8 30 7 33 9 28 .9 29 .9 29 .4 30 .6 30 .8 12 4 13 1 14 9 19 9 24 7 31 0 32 6 38 0 53 0 6 71 32 .0 ... K 333 :N S 3 34 :N S 3 34 :O N 338 :N S3 95: N S3 95: O G397:O S378:O A379:O 2. 84 2. 79 2. 84 3. 22 2. 72 2.90 3. 22 3. 32 3. 41 3. 25 3. 27 2. 73 2. 82 2. 83 3. 04 2. 97 2. 85 2. 70 3. 46 3. 24 2. 96 2. 96 3. 86 3. 85 4. 47 3. 72 3. 65 ... N 23 1 :N I 23 4 :N K 3 31 :N Q 3 32 :N Q 3 32 :O N 336 :N S3 92: N S3 92: O G3 94: O T3 75: O A376:O 3. 00 2. 74 2. 98 2. 66 2. 83 2. 68 4. 42 5. 54 4. 03 3.80 4. 44 2. 83 2. 84 2. 71 3. 25 2. 89 2. 95 2. 97 4. 62 4. 47 3. 82 3. 88 2. 98 2. 78...
- 19
- 460
- 0
Báo cáo khoa học: "Gas exchange and water relations of 3 sizes of containerized Picea mariana seedlings subjected to atmospheric and edaphic water stress under controlled conditions" pps
... 16 , 1 15 - REFERENCES Bernier PY (19 92) Soil texture influences seedling water stress in more ways than one Tree Planters’ Notes 43 , 39 - 42 Bernier PY (19 93) Comparing natural and planted black spruce ... where going use we are for forest manageand where we are For Chron 66, 35 5 -36 0 Coutts MP (19 81) Effects of root or shoot exposure before planting on the water relations, growth, and survival of ... 1 25 - 13 0 Burdett AN (19 90) Physiological processes in plantation establishment and the development of specifications for forest planting stock Can J For Res 20 , 4 15 - 42 7 Campbell RA (19 90) Herbicide...
- 9
- 201
- 0
Organocatalytic reactions of 3 hydroxy 2 pyrone and n arylsulfonyl 3 hydroxy 2 pyridone 1
... 20 02, 41 , 1 650 -16 67 Shen, J.; Tan, C H Org Biomol Chem 20 08, 6, 32 29 - 32 36 (a) Koerner, M.; Rickborn, B J Org Chem 19 89, 54 , 6-9 (b) Koerner, M.; Rickborn, B J Org Chem 19 90, 55 , 26 62- 26 72 (a) Riant, ... Tetrahedron Lett 19 89, 30 , 74 03- 740 6 (b) Riant, O.; Kagan, H B.; Ricard, L Tetrahedron 19 94, 50 , 45 43 - 45 5 4 Tokioka, K.; Masuda, S.; Fujii, T.; Hata, Y.; Yamamoto, Y Tetrahedron: Asymmetry 19 97, ... N-substituted-3hydroxy -2- pyridone Chapter References 10 11 12 13 14 Nicolaou, K C.; Snyder, S A.; Montagnon, T.; Vassilikogiannakis, G Angew Chem Int Ed 20 02, 41 , 16 68 -16 98 Corey, E J Angew Chem Int Ed 20 02, ...
- 10
- 463
- 0
Organocatalytic reactions of 3 hydroxy 2 pyrone and n arylsulfonyl 3 hydroxy 2 pyridone 2
... Ph rt 82 33 (9) 3a Et2O Ph rt 80 45 ( 0) 3a MeOH Ph rt 81 3( 0) 10 3a MeCN Ph rt 82 5( 0) 11 3a CH2Cl2 Ph -20 80 81 (20 ) 12 3a CH2Cl2 Ph -40 82 85( 15 ) 13 3a CH2Cl2 Ph -40 81 88 (28 ) 14 3a CH2Cl2 Cy -40 ... DMSO 15 0 .5 VAP 1, 82 DMSO 15 0 .5 VAP 2, 75 DMSO 15 0 .5 VAP 3, 80 DMSO 15 24 VAP 4, 51 b DMSO 15 18 VAP 5, 84 DMSO 15 48 VAP 6, 46 Neat 30 48 VAP 7, 80 DMSO 15 24 VAP 8, 82 DMSO 15 24 VAP 9, 75 Entry ... Entry Solvent R Temp/oC Yield/%a ee/%b 3a CH2Cl2 Ph rt 90 65 (2) 3b CH2Cl2 Ph rt 85 32 (0) 3c CH2Cl2 Ph rt 88 11 (7) 3d CH2Cl2 Ph rt 91 40 (0) 3a PhMe Ph rt 92 50 (5) 3a THF Ph rt 86 26 (0) 3a CHCl3...
- 31
- 218
- 0
Organocatalytic reactions of 3 hydroxy 2 pyrone and n arylsulfonyl 3 hydroxy 2 pyridone 3
... 2b (CH2Cl )2, rt 86 38 4b 3b Ph, 2b Et2O, rt 82 28 4b 3b Ph, 2b THF, rt 80 12 4b 3b Et, 2e CH2Cl2, rt 80 35 10 4b 3b Bn, 2c CH2Cl2, rt 82 43 11 4b 3b 4- MeC6H4, 2f CH2Cl2, rt 81 47 12 a 4d 4b 3b ... SO2Ar N Solvent Yield/%a ee/%b Temp/oC or 3d 3b Ph, 2b CH2Cl2, rt 90 40 4d 3d Ph, 2b CH2Cl2, rt 85 4b 3b Ph, 2b CH2Cl2, rt 88 36 4b 3d Ph, 2b CH2Cl2, rt 91 14 4b 3b Ph, 2b CHCl3, rt 92 41 4b 3b ... CH2Cl2, rt HO O 15 OEt Entry CH2Cl2 : ethyl acrylate Time/days Yield/%a ee/%b : 10 0 95 29 20 : 80 95 31 40 : 60 10 90 49 60 : 40 12 90 50 80 : 20 13 85 53 91 : 14 75 53 a b Isolated yield Chiral...
- 32
- 227
- 0
Organocatalytic reactions of 3 hydroxy 2 pyrone and n arylsulfonyl 3 hydroxy 2 pyridone 4
... 22 .6, 25 .3, 44 .6, 47 .8, 51 .4, 78.0, 12 6 .2, 12 9 .0, 12 9 .1, 12 9 .2, 13 1 .1, 13 1 .5, 1 32 .2, 13 7 .3, 14 1.0, 14 4. 7, 17 0 .5, 1 72. 1, 1 72. 5 FTIR (KBr): 677, 9 04, 11 04, 11 64, 13 4 6, 13 9 1, 17 17, 17 45 , 29 82, 35 13 ... 21 .1, 22 .6, 25 .3, 44 .4, 47 .7, 51 .4, 53 . 4, 63. 7, 78.0, 1 15 . 0, 1 23 . 4, 12 7 .3, 12 8 .9, 13 1 .6, 1 32 .2, 13 7 .2, 14 1.0, 14 4. 7, 15 9 .2, 17 0 .5, 1 72. 4, 1 72. 8 FTIR (KBr): 6 74, 1 13 7 , 11 71, 1 23 2 , 13 4 6, 14 08, 16 86, ... 31 .3, 44 .7, 48 .1, 51 .2, 79 .2, 12 0 .4, 12 6 .1, 12 9 .0, 12 9 .3, 13 1 .2, 13 1 .7, 1 32 .2, 14 1.0, 14 4. 6, 15 0 .3, 17 1.0, 1 72. 2, 1 72. 7 FTIR (KBr): 6 73, 10 99, 11 69, 1 35 0, 13 8 3, 17 16, 2 933 , 29 61, 34 61 cm -1 LRMS...
- 60
- 243
- 0
nvestigating the influences of tidal inundation and surface elevation on the establishment and early development of mangroves for application in understanding mangrove rehabilitation techniques 1 3
... Sonneratia 3. 35 – 3. 96 20 – 45 tides Spring high Rhizophora spp., Ceriops, Bruguiera 3. 96 – 4 .57 – 20 tides Lumnitzera, Bruguiera, Acrostichum aureum Equinoctial 4 .57 and above tides Up to Ceriops ... effect on mangroves primarily through their roots Roots will exhibit lower oxygen partial pressures in the root aerenchyma (McKee, 19 96) and enter anaerobic respiration for short durations, allowing ... and durations, characteristic of lower intertidal positions (Ellison & Farnsworth, 19 93) The relative growth rates of Bruguiera gymnorrhiza decreased as inundation duration increased, while Kandelia...
- 16
- 330
- 0
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx
... L92F L92E L92D WT L92C F 15 0 10 0 80 60 40 F 15 0 Y F 15 0 V F 15 0 W F 15 0 T F 15 0 S F 15 0R F 15 0 Q F 15 0 P F 15 0 N F 15 0 L F 15 0 M F 15 0 K F 15 0 I F 15 0 H F 15 0 G F 15 0 E F 15 0 D WT 20 F 15 0 C Relative activity (%) found to be in ... L92T F6 3R L9 2R F63P F63Q L92Q F63N F63L F63M F63I F63K F63H F63E F63G F63D WT F63C L 92 12 0 Relative activity (%) 10 0 80 60 40 20 L92P L92N L92K L92M L92I L92H L92G L92F L92E L92D WT L92C F 15 0 10 0 ... amidohydrolase activity Eur J Biochem 2 13 , 13 1 5 1 32 4 43 Schwede T, Kopp J, Guex N & Peitsch MC (20 03) SWISS-MODEL: an automated protein homology-modeling server Nucleic Acids Res 31 , 33 81 33 85 44 Notredame...
- 14
- 621
- 0
Tài liệu Báo cáo khoa học: Biochemical and molecular characterization of hazelnut (Corylus avellana) seed lipoxygenases pdf
... and CAAT signals are present at position 41 4 0 ( )40 from the ATG) and 40 66 ( )11 4) , respectively In the 5 upstream untranslated region, we also found four inverted repeats (20 4 23 7 bp; 646 –7 15 ; ... 10 , 29 7 30 2 25 Knox, M., Forster, C., Domoney, C & Casey, R (19 94) Structure of the Pisum sativum seed lipoxygenase gene lox1:Ps :3 Biochim Biophys Acta 12 1 4, 34 1 34 3 26 Domoney, C., Firmin, J.L., ... functions, catalysis and acquisition of substrate J Biol Chem 27 4, 23 6 79– 23 6 82 Feussner, I & Wasternack, C (20 02) The lipoxygenase pathway Annu Rev Plant Biol 53 , 27 5 29 7 Ó FEBS 20 03 Porta, E & Rocha-Sosa,...
- 11
- 404
- 0
MORPHOGENESIS THE CELLULAR AND MOLECULAR PROCESSES OF DEVELOPMENTAL ANATOMY pptx
... QH4 91. B37 19 90, 19 92 57 4 .3' 32- dc20 89 -17 4 15 CIP ISBN- 13 978-0- 52 1 -36 19 6 -5 hardback ISBN -10 0- 52 1 -36 19 6-6 hardback ISBN- 13 978-0- 52 1 - 43 6 12 - 0 paperback ISBN -10 0- 52 1 - 43 6 12 - 5 paperback Transferred ... cornea 3. 6 Lessons from the case studies 24 24 25 28 34 49 59 The molecular basis of morphogenesis 4 .1 Introduction 4 .2 The extracellular matrix (ECM) 4 .3 The cell membrane 4. 4 The intracellular contribution ... 12 0 12 0 12 2 1 45 vi Contents 5. 4 Condensation 5. 5 Growth and death 15 1 1 73 The epithelial repertoire 6 .1 Introduction 6 .2 Polarity 6 .3 Palisading 6 .4 Changing the shape of epithelia 6 .5 Enlargement...
- 324
- 404
- 0
Báo cáo khoa học: Assembly and molecular mode of action of the Helicobacter pylori Cag type IV secretion apparatus doc
... hp0 52 0 hp0 52 1 a hp0 52 2 hp 05 23 hp0 52 4 hp0 52 5 hp0 52 6 hp0 52 7 hp0 52 8 hp0 52 9 hp0 53 0 hp0 53 1 hp0 5 32 hp0 53 4 hp0 53 5 hp0 53 6 hp0 53 7 hp0 53 8 hp0 53 9 hp 0 54 0 hp 0 54 1 hp 05 42 hp 05 43 hp 0 54 4 hp 0 54 5 hp 0 54 6 NA hp 0 54 7 ... Core complex, VirB8 33 ,38 18 49 , 52 40 , 41 38 ,49 , 53 22 , 34 ,36 22 Core complex, OM lipoprotein, VirB7 22 ,33 , 35 54 OM complex 22 55 42 36 Integrin binding, VirB5 Secretion chaperone ATPase, VirB3 ... Journal 27 8 (20 11 ) 12 03 12 1 2 ª 20 11 The Author Journal compilation ª 20 11 FEBS W Fischer 20 21 22 23 24 25 26 27 28 29 30 31 32 Suerbaum S & Josenhans C (20 06) Characterization of the pilin ortholog...
- 10
- 393
- 0
Báo cáo khóa học: Biochemical and molecular characterization of a laccase from the edible straw mushroom, Volvariella volvacea docx
... system of Vol- 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 variella volvacea, the edible straw mushroom Appl Environ Microbiol 65, 5 53 55 9 Buswell, J.A., Mollet, B & Odier, E (19 84) Ligninolytic ... 8.6 25 20 0.7 0 .5 1 .3 1. 4 3. 6 11 .9 13 17 .2 10 0 94 77 37 30 22 1. 1 2. 8 9 .2 10 14 by SDS/PAGE and by isoelectric focusing combined with silver staining (data not shown) After a five-step purification ... number AY280 633 ) The PCR cycle programme was: 94 °C for min; 23 cycles of 94 °C for 20 s, 52 °C for 20 s and 70 °C for min; then a final extension at 72 °C for 10 The primers for lac1 PLAC1F (5 -AGCTTT...
- 11
- 703
- 0
Báo cáo khoa học: Functional fine-mapping and molecular modeling of a conserved loop epitope of the measles virus hemagglutinin protein pdf
... No 22 7 20 3 2 2 2 1 1 1 1 1 1 1 1 1 76.69 6.76 2. 70 1 . 35 1. 01 1. 01 0.68 0.68 0.68 0.68 0.68 0.68 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 0 . 34 ... systemic neutralizing 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 antibodies after intranasal co-immunization with measles virus J Gen Virol 76, 13 7 1 13 8 0 Hu, A & Norrby, E (19 94) Role of individual ... (Eur J Biochem 27 0) ¨ 10 11 12 13 14 15 16 17 18 19 20 21 22 23 by monoclonal antibodies binding to a cystine loop domain of the H protein mimicked by peptides which are not recognized by maternal...
- 13
- 492
- 0
Báo cáo khoa học: Enzymatic characterization and molecular modeling of an evolutionarily interesting fungal b-N-acetylhexosaminidase pot
... n.i 5 63 ± 17 51 1 1. 01 ± 0. 02 n.i 22 7 ± 22 4 1. 04 ± 0.06 n.i 7 23 ± 21 6 95 2. 02 ± 0 .22 n.i 41 9 ± 20 7 0.07 ± 0. 01 0.06 ± 0. 01 16 ± 1a 22 9a 0. 05 ± 0. 01 0. 05 ± 0. 01 43 ± 3a 860a 0 . 14 ± 0. 01 0. 75 ± ... 10 66 CCF 1 959 CCF 34 38 CCF 10 66 CCF 1 959 CCF 34 38 CCF 10 66 Km (mM) Kss (mM) kcat (s )1) kcat ⁄ Km (s )1 mM )1) 0 . 14 ± 0. 01 0. 41 ± 0. 03 10 1 ± 2a 7 21 a 0. 13 ± 0. 01 0 . 54 ± 0. 04 34 7 ± 13 a 26 69a 1. 10 ± 0.07 ... Dauter Z, Wilson KS & Vorgias CE (19 96) Bacterial chitobiase structure FEBS Journal 27 8 (20 11 ) 24 69 24 84 ª 20 11 The Authors Journal compilation ª 20 11 FEBS ˇ ´ H Ryslava et al 10 11 12 13 14 15 16 ...
- 16
- 429
- 0
Báo cáo khoa học: Sequences, geographic variations and molecular phylogeny of venom phospholipases and threefinger toxins of eastern India Bungarus fasciatus and kinetic analyses of its Pro31 phospholipases A2 docx
... Kerver J, van Meersbergen J, Vis R, Dijkman R, Verheij HM & de Haas GH (19 90) Influence of size and polarity of residue 31 in porcine pancreatic 52 4 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 ... Mass (Da) N-Terminal sequence determined 11 15 23 0.7 0.6 0 .4 13 0 79 13 0 93 13 0 51 13 0 03 13 4 12 13 1 70 13 1 56 ± ± ± ± ± ± ± 1 1 1 NLLQFKNMIQ CAGSRLWVAY NLLQFKNMIQ CAGSRLWVAY NLYQFKNMIE CAGTRTWLAY NLLQFKNMIE ... CAA699 71, AAL30 0 54 -5, P 15 8 16 , CAA 72 43 4 , O 12 9 62, Q9W 729 ; and B fasciatus (Bf): Bf-IV [59 ], BfVII -1 P10808, VIIIa [10 ], fasciatoxin P 14 53 4 ntx, neurotoxin Summary and conclusions Intrageneric and intraspecies...
- 14
- 432
- 0
Báo cáo khoa học: Purification, characterization and molecular cloning of tyrosinase from the cephalopod mollusk, Illex argentinus docx
... 6.8 3. 2 1 .3 0 .49 9 .3 0 .57 0 . 32 0 . 32 55 .4 29 .4 51 .2 0 .47 8 28 .8 0 .19 4 0 . 21 6 1 .59 12 9 68.7 12 0 1. 12 67 .3 0 .4 53 0 .50 5 3. 72 19 21 92 2 .3 7 .2 0.79 1. 6 12 6 .5 2. 7 0 .39 0 . 24 7 .3 0 . 35 0 . 24 0. 12 268 13 6 1 85 ... 1 85 3. 56 19 7 8. 74 7.98 27 .6 57 0 28 9 39 3 7 .57 41 8 18 .6 17 .0 58 .7 88 11 0 10 00 32 57 53 71 49 0 4. 6 5 .2 11 14 7.9 67 44 41 than that for the D-isomer The same tendency was observed for isomers of ... spectroscopic studies of the structure in solution and 46 47 48 49 50 51 52 53 54 55 56 the conformational stability of the native protein and its structural subunit Biochem J 31 5, 13 9 14 4 Gerday,...
- 13
- 342
- 0
Báo cáo khoa học: Cellular and molecular action of the mitogenic protein-deamidating toxin from Pasteurella multocida pptx
... Journal 27 8 (20 11 ) 4 616 4 6 32 ª 20 11 The Authors Journal compilation ª 20 11 FEBS B A Wilson and M Ho 11 0 11 1 1 12 1 13 11 4 1 15 11 6 11 7 11 8 11 9 12 0 12 1 12 2 1 23 gamma-subunits in development of their biological ... -DDVPMDHYVAVFDIDGYQLVVDPTIKQMVDKSKHVKNILNALNITKPNDKNIFYG 1 23 8 25 1 28 8 25 82 17 8 26 40 30 31 6 53 6 03 19 64 22 7 97 PMT_C3 SseI_E SseI_A PhAs ArNa ViCo ViFi Meso ETA ChVi VFMJ YMo 1 23 9 25 2 28 9 25 83 17 9 26 41 30 32 6 54 6 04 19 65 22 8 98 * PVDDWALEIAQRNRAIN ... Gaolf2 (NP_79 611 1), Ga 11 (NP_ 0 34 4 31 ), Gaq (NP_ 0 32 1 65) , Ga 14 (NP_ 0 32 1 63) , Ga 15 (NP_ 0 34 43 4 ), Ga 12 (NP_ 0 34 4 32 ) and Ga 13 (NP_ 0 34 43 3 ) The numbers below the alignment correspond to the amino acid positions...
- 17
- 402
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25