pin proteins perform a rate limiting function in cellular auxin efflux 914
Báo cáo y học: " High blood pressure, antihypertensive medication and lung function in a general adult population"
... other antihypertensive treatment is associated with reduced lung function in a general adult population Thus, our findings may serve as a basis for experimental testing, as for example by adding ... Greifswald, Greifswald, Germany 7Central Hospital of Augsburg, MONICA/KORA Myocardial Infarction Registry, Augsburg, Germany 8Ludwig-Maximilians-University, Institute of Medical Data Management, ... Germany Authors’ contributions ES was responsible for the data analysis, interpretation of data and manuscript preparation JH and ES developed the statistical analysis plan SK, HS, SG, CM, MH, AP,...
- 8
- 579
- 1
Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc
... membrane and immunoblotted with an anti-actin mAb (left) Equivalent amounts of purified yeast actin were used in each binding assay and an amount representing 10% of the load used in each binding assay ... pAM237 pAM241 pAM252 pAM253 pAM872 pAM873 pAM874 pAM875 pAM876 pAM877 pAM878 pAM879 pAM880 pAM881 pAM882 pAM883 pAM884 pAM885 pAM886 pAM887 pAM888 pAM889 pAM890 pAM891 pAM892 pAM895 pAM896 pAM899 ... GFP-specific antiserum was a gift from J Kahana and P Silver (Dana Farber Cancer Center, Boston, MA) The anti-actin mAb was MAB1501 from Chemicon International (Temecula, CA) The anti-hexokinase rabbit...
- 23
- 679
- 0
Tài liệu Báo cáo khoa học: Differentiation stage-dependent preferred uptake of basolateral (systemic) glutamine into Caco-2 cells results in its accumulation in proteins with a role in cell–cell interaction pptx
... extracellular lectin, which interacts with intracellular glycoproteins, cell surface proteins and extracellular matrix proteins Overexpression of galectin-3 in human breast carcinoma cell lines ... to a family of soluble cytoplasmic proteins that can bind to the membrane surface in response to elevations in intracellular calcium [45] Annexin A2 is an F-actin binding protein and participates ... Glutamine incorporation in Caco-2 proteins determining the relative uptake of glutamine; (b) by searching for changes in the intestinal proteome; and (c) by examining glutamine incorporation into...
- 15
- 506
- 0
Báo cáo Y học: Dystrobrevin requires a dystrophin-binding domain to function in Caenorhabditis elegans doc
... (and GST alone) after incubation with equal amounts of in vitro translated 35 S-labelled DYS-1 The signal intensity of the autoradiogram was quantitated with a radiographic analyser (Biorad) MW, ... the in vivo function of Dyb-1, we created transgenes Fig Yeast two-hybrid assay A plate containing SD media minus leucin, tryptophan and histidine was seeded with yeast carrying DNABD-Dys-1 and ... (typically 0–10 min) The reactions were stopped by adding EGTA to mM and heating at 65 °C for 10 DNA was purified on a Wizard column (Promega) and the action of BAL31 was checked by loading an aliquot...
- 6
- 334
- 0
Reproductive System Structure, Development and Function in Cephalopods with a New General Scale for Maturity Stages pot
... and appear granular Oocytes are at intercalary and protoplasmic growth phase AG are completely formed and usually white Gonad is large, usually dullwhite Spermatozoa accumulate in testis ampullae ... spermatophoric gland Stage VI Mature sexual cells pass through the accessory glands In all cephalopod females this stage occurs at spawning In males, spermatophores accumulate in the distal part ... female octopus, mucous egg mass of female squid and spermatophores of male squid Therefore, it seems inappropriate to include functional maturation and maturity in a single maturity stage (as in...
- 12
- 623
- 0
Báo cáo khoa học: Kinetic deuterium isotope effects for 7-alkoxycoumarin O-dealkylation reactions catalyzed by human cytochromes P450 and in liver microsomes Rate-limiting C-H bond breaking in cytochrome P450 1A2 substrate oxidation pdf
... is that P450 1A2 is a major catalyst of the model alkoxycoumarin reactions in human liver The actual substrate oxidation step is rate- limiting, as opposed to steps involved in the generation ... containing 10 mm HClO4, a flow rate of 1.0 mLÆmin)1, and monitoring at A3 30 [19] Kinetic parameters (Km and kcat) were determined using nonlinear regression analysis with Graph-Pad prism software ... Results and discussion Intramolecular kinetic isotope effects The intramolecular kinetic isotope effects measure the comparative rates for cleavage of a C-H bond and a C-D bond at a single carbon...
- 9
- 314
- 0
Báo cáo khoa học: An a-proteobacterial type malate dehydrogenase may complement LDH function in Plasmodium falciparum Cloning and biochemical characterization of the enzyme potx
... appropriate primers (Pf LDH: forward 5¢-ATGGCACCAAAAGCAAAAATCG-3¢ and reverse 5¢-AGCTAATGCCTTCATTCTCTTAG-3¢; Pf MQO forward 5¢-ATGATATGTGTTAAAAATATTTTG-3¢ and reverse 5¢-TCATAAATAATTAACGGGATATTCG-3¢) ... LEIVNLHA—-SPYVAPAAAIIEMAESYLKDLKKVLICSTLLE-G-QYGHSD-IFGGTPVV AEIIKLAK-ASAAFAPAAAITKMIKSYLYNENNLFTCAVYLN-G-HYNCSN-LFVGSTAK GEIVKLLKTGSAYYAPAASAIAMLESYLKDKRQILTCAAYLQ-G-EYDIHD-LYIGVPII AEIVGLLKTGSAYYAPAASAIEMAESYLKDKKRVLPCAAHLS-G-QYGVKD-MYVGVPTV ... NADP/NADPH as an alternate cofactor, having been tested up to maximum concentration of 100 mM A surprising observation was the use of acetyl pyridine adenine dinucleotide (APAD/ APADH) as an alternate...
- 15
- 508
- 0
WORKING PAPER SERIES NO. 580 / JANUARY 2006: BANK INTEREST RATE PASS-THROUGH IN THE EURO AREA A CROSS COUNTRY COMPARISON ppt
... years initial rate fixation floating rate and up to year initial rate fixation over years initial rate fixation over and up to years initial rate fixation floating rate and up to year initial rate ... rate fixation over and up to years initial rate fixation floating rate and up to year initial rate fixation over years initial rate fixation floating rate and up to year initial rate fixation over ... data; average 1999-2003 LT assets/total assets vs LT liabilities/total liabilities; annual data; average 1999- 2003 annual data; average 1999-2003 annual data; average 1999-2003 annual data; average...
- 65
- 542
- 0
Báo cáo khoa học: A possible physiological function and the tertiary structure of a 4-kDa peptide in legumes potx
... 4-kDa peptide N-terminal primer: 5¢-AACCATGGCTAAAGCAGATTGTAATGG TGCATGT-3¢; the 4-kDa peptide C-terminal primer: 5¢-AAGAATTCTTATTATCCAGTTGGATGTATGCA GAA-3¢ The amplified sequence was cloned into ... insulin pharmacophore, IleA2-ValA3 at the A- chain N-terminus, TyrA19 at the A- chain C-terminus, and ValB12 and TyrB16 at the B-chain central helix assume essentially the same spatial arrangements ... protein was detected with anti-(4-kDa peptide) Ig Ligand: (A) normal 4-kDa peptide; (B) Arg16fiAla mutant; (C) Val29fiAla mutant; (D) Phe31fiAla mutant signalling pathway This signalling mechanism...
- 8
- 386
- 0
Báo cáo hóa học: "IL-2 as a therapeutic target for the restoration of Foxp3+ regulatory T cell function in organ-specific autoimmunity: implications in pathophysiology and translation to human disease" doc
... T, Nakanishi K, Shimada A, Uga M, Kurihara S, Kawabata Y, et al: Genetic association between the interleukin-2 receptor-alpha gene and mode of onset of type diabetes in the Japanese population ... polymorphisms in the IL2RA gene are associated with age at diagnosis in late-onset Finnish type diabetes subjects Immunogenetics 2010, 62:101-107 36 Kawasaki E, Awata T, Ikegami H, Kobayashi T, Maruyama ... immune tolerance requires a finely controlled balance between maintaining tolerance to self-antigens and mounting protective immunity against enteric and invading pathogens [1] Self-reactive T cells...
- 12
- 573
- 0
Báo cáo hóa học: " Dipolar cortico-muscular electrical stimulation: a novel method that enhances motor function in both - normal and spinal cord injured mice" pdf
... data from motor unit firing in humans and animals after SCI [46,47] and with results from intracellular recordings from sacrocaudal motoneurons that show a sustained and exaggerated firing rate ... White matter staining Behavioral assessment At the end of each experiment, animals were injected with a lethal dose of Ketamine Two parts of the spinal column (including vertebrae and spinal cord) ... descending brain-stem-released serotonin (5-HT) or noradrenalin [49-51] Here the increase in the spontaneous firing rate and the appearance of modulated activity in some animals after dCMS may indicate...
- 15
- 639
- 0
báo cáo hóa học: " A prospective study of decline in lung function in relation to welding emissions" pdf
... ever-welding Danish metal workers N Welders Mild steel Stainless steel Alloyed steel Aluminum All particulates manual metal arc (MMA) metal active gas (MAG) manual metal arc (MMA) tungsten inert gas ... 6.7 years Age at baseline was 17–30 years The overall annual decline in FEV1 was 11.1 ml Continuing smoking was associated with increased loss in FEV1 and atopy in smokers further increased the ... Blood samples were collected in a dry tube and analysed the same day or frozen at -20°C until analysed using a Beckman Coulter Immage® kit, Beckman Coulter, CA, USA All measurements of alfa-1-antitrypsin...
- 8
- 437
- 0
báo cáo hóa học: " Lung function in asbestos-exposed workers, a systematic review and meta-analysis" pdf
... analysis DW, UM and MVG extracted and analysed the data All authors collaborated in interpreting the data and writing the manuscript and read and approved the final manuscript Page 14 of 16 10 11 12 ... of the included studies indicate that the radiological findings can only explain a small part of the variability in these parameters Other authors have also reported a medium to low explanatory ... occupational exposure to asbestos Only studies that applied an internationally accepted quality standard for lung function testing (i.e ATS standard, ERS standard) and that provided information about...
- 16
- 357
- 0
báo cáo hóa học:" Dynamic magnetic resonance imaging in assessing lung function in adolescent idiopathic scoliosis: a pilot study of comparison before and after posterior spinal fusion" doc
... Joint Surg Br 1985, 67(5):699-702 Kotani T, Minami S, Takahashi K, Isobe K, Nakata Y, Takaso M, Inoue M, Maruta T, Akazawa T, Ueda T, Moriya H: An analysis of chest wall and diaphragm motions in ... reformatted axial image Measurement of AP and TS diameter of the chest wall on the reformatted axial image (a) Upper level at the carina (C), maximal inspiratory image (b) Lower level at the apical vertebra ... Figure Measurement of diaphragmatic heights on the reformatted coronal image Measurement of diaphragmatic heights on the reformatted coronal image (a) At maximal inspiratory image and (b) maximal expiratory...
- 7
- 410
- 0
Báo cáo hóa học: " Blind recovery of k/n rate convolutional encoders in a noisy environment" pdf
... algorithm-based approach was developed and applied to the case of a rate 1/2 convolutional encoder [13] At nearly the same time, a probabilistic algorithm based on the Expectation Maximization (EM) algorithm ... used in the following section dedicated to the analysis and performances study of our blind identification method Analysis and performances In order to gain more insight into the performances ... http://jwcn.eurasipjournals.com/content/2011/1/168 parameters can be realized by solving the system described in Property In [15,17], a similar approach, based on a rank calculation, is used to identify the size of an interleaver In this article,...
- 9
- 495
- 0
Báo cáo hóa học: " Research Article Evaluation of Cross-Layer Rate-Aware Routing in a Wireless Mesh Network Test Bed" pdf
... transmission rates are usually more error-prone Traditional layered approach relegates rate adaptation mechanism to the MAC layer, without any interaction with the routing layer This layered design ... elegant from an architectural perspective, leads to under-exploit the wireless medium Instead, rate- aware routing that chooses links offering high transmission rates is able to increase the average ... avoid paths having bottleneck links that offer low transmission rate Links with low data rate increase congestion, interference, and delay Furthermore, as our measure proves, links with low transmission...
- 10
- 344
- 0
Báo cáo hóa học: "Approaching the MIMO Capacity with a Low-Rate Feedback Channel in V-BLAST" docx
... low -rate feedback channel, [13] introduced rate adaptation at each antenna in V-BLAST to overcome this problem We extend their approach to both rate and power adaptations at each antenna and ... is generated 1000 times and the average capacity is calculated assuming that a scalar capacity-achieving code is used: Γ = at (1) First, the effect of rate quantization is investigated; later, ... performance is limited by the antenna with the smallest capacity, as dictated by the channel Hence, it is natural to consider per-antenna rate adaptation using a low -rate feedback channel Using a...
- 10
- 221
- 0
Báo cáo khoa học: "Relationship of cognitive function in patients with schizophrenia in remission to disability: a cross-sectional study in an Indian sample" pps
... Srinivasan L, Thara R, Tirupati SN: Cognitive dysfunction and associated factors in patients with chronic schizophrenia Indian J Psychiatry 2005, 47:139-143 Ananthanarayanan CV, Janakiramaiah N, Gangadhar ... Assessment Scale) – A Scale for Measuring and Quantifying Disability in Mental Disorders Chennai: Indian Psychiatric Society; 2002 American Psychiatric Association: Diagnostic and Statistical Manual of ... Trail making tests A and B Trail making tests A and B have been commonly used and validated in the Indian population [23] Trail shift scores were calculated by subtracting the time taken on Trail...
- 8
- 397
- 0
Báo cáo y học: " Kennedy Institute of Rheumatology Division, Imperial College London, 12–13 November 2003: Towards a molecular toolkit for studying lymphocyte function in inflammatory arthritis" ppt
... (Birmingham University, UK) has characterised CD8+CD45RA+ cells found in rheumatoid synovial infiltrates Synovial CD8CD45RA+ cells are LFA-1high memory cells, containing Epstein–Barr virus tetramer ... unfolds and that the peptidebinding groove can accommodate a peptide much longer than a nonamer Expression of HLA-B27 heavy chain in cells deficient in TAP (transporter associated with antigen ... tolerated for decades, without global immunosuppression, they seem a promising therapeutic strategy for Th1-dominant inflammatory diseases, such as RA Homing and effector function Frances Hall...
- 5
- 256
- 0
Effect of cyclooxygenase inhibition on cholesterol efflux proteins and atheromatous foam cell transformation in THP-1 human macrophages: a possible mechanism for increased cardiovascular risk pot
... for patent ductus arteriosus in premature infants: efficacy of a dosing strategy based on a seconddose peak plasma indomethacin level and estimated plasma indomethacin levels Am J Perinatol 2004, ... isolated and ABCA1 detected with specific rabbit polyclonal anti-ABCA1 antibody Western blotting was performed with an antiβ-actin antibody to confirm equal protein loading ABCA1, ATP-binding cassette ... experimental data Statistical analysis was performed using SigmaStat version 2.03 (SPSS Inc., Chicago, IL, USA) Data was analyzed using the Kruskal-Wallis one-way analysis of variance on ranks Pairwise...
- 11
- 223
- 0
Tìm thêm: xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến mômen quay m fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25