... proteases of the coagulation system including thrombin (factorIIa) and factors IXa, Xa, XIa and XIIa. The princi-pal targets of the serpin are usually regarded as beingthrombin and factor Xa, although ... immediate and medium term future.AcknowledgementsThis work was supported by the National Health &Medical Research Council of Australia, the Austra-lian Research Council, the National Heart ... thrombin anion-bindingexosite-1 is a primary part of the allosteric activationmechanism.For many years, the physiological activator of HC-IIhas been assumed to be extravascular dermatan sulfate[56–64],...
... lit by candles anddraped with gathered curtains that turned the walls into the proscenia of a grand and ancient stage. There were four or five small tables and a long one at the back of the room, ... the neat stitching that ran the bind-ing and the spine, holding together the nylon and the denim, taken from a pair of jeans, a backpack. The end-papers were yellowed page threegirls fromthe ... he'd joined the Order, andshe wasn't there anymore. Her numbers all rang dead. The apartment building had once been a pleasant, middle-class sort ofplace, witha red awning and a niche...
... the NN – they had another better help before the NN contacted them. The NN took the primary contact to the femalepatients and offered help in the early part of a cancertrajectory. The NN was ... what kind of add-itional helpthe patients should have. Navigators incancer care have been proposed to embrace this extra help. They helpthe cancer patient “not only travel the healthcare maze ... I have heardnothing. I find that scary. (At discharge)Doctors . come and go as they see fit . they comeand say their bit and then they leave again (ye s)they can go as far as to turn their...
... house was illuminated in a very elegant manner with variegated lamps, the principal figure in which was the letters 'G.R.' immediately over the coat-of-arms. A band of music with horns ... PALMER AT THE AGE OF 75. CHAPTER V. [Pg 45] APPRECIATIONS OF RALPH ALLEN, JOHN PALMER, AND SIR FRANCIS FREELING, MAIL AND COACH ADMINISTRATORS. On the 25th April, 1901, the day after a ... Street. The Gloucester and Aberystwith mail-coach continued to run until the year 1854, and it is believed that was the last regular main road mail-coach which was kept on the road. Its guard from...
... oxidase from Paracoccusdenitrificans. Nature 376, 660–669.8. Tsukihara, T., Aoyama, H., Yamashita, E., Tomizaki, T., Yamaguchi, H., Shinzawa-Itoh, K., Nakashima, R., Yaono, R. &Yoshikawa, ... sealed with another CaF2plate, and placed into a metallic sample holder. The following cuvette handlingwas carried out in the aerobic atmosphere. The absorbancespectra of the mixture before and ... proton-translocating channels, called the K- andD-channels. The D-channel contains an array of charged orpolar amino acids, and is located within two differenthydrogen-bonded networks above and...
... 489–495.4 Kinoshita S, Terada T, Taniguchi T, Takene Y, Masu-da S, Matsunaga N & Okada H (1981) Purification andcharacterization of 6-aminohexanoic acid oligomerhydrolase of Flavobacterium sp. ... S& Higuchi Y (2005) Crystallization and x-ray diffrac-tion analysis of 6-aminohexanoate-dimer hydrolase from Arthrobacter sp. KI72. Acta CrystallogrF61,928–930.15 Hatanaka HS, Fujiyama ... potentially possesses an advantage for biotechnological applications.X-ray crystallographic analyses of the G181D ⁄ H266N ⁄ D370Y enzyme and the inactive S11 2A- mutant–Ald complex revealed that Ald...
... CAGGCTCGTGGTGCTAAATGCCCGAACTGCCTGTGCTGTG3f GTAAGTACGGCTTCTGCGGTTCTGGTGACGCTTACTGTGG4f CGCTGGTTCTTGCCAGTCTCAGTGCCGTGGTTGCTAGGGAT1r TTTAGCACCACGAGCCTGGTCACCGCAACGCTGAGC2r CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG3r ... CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG3r GACTGGCAAGAACCAGCGCCACAGTAAGCGTCACCAReverse GCTAGGATCCCTAGCAACCACGGCACTable 2. Antifungal activity of WAMP- 1a. IC50is the concentrationnecessary for 50% growth inhibition.Fungi ... Escherichia coli and assays of recombinant WAMP- 1a activity against diverse plant pathogens, such aschitin-containing and chitin-free fungi, and Gram-positive and Gram-negative bacteria. The amino acidsequence...
... DNA lesions depends on the capacity of the cell to repair the damage before it can be incorporatedpermanently into the genome. Typically, DNA damage isrepaired at a relative high rate in human ... survival) after irradiation. The in vivobiological activity was assayed by the ability to prevent UVinduced erythema of human skin. After informed consentand approval fromthe Ethical Committee ... cyanobacteria,corals and other marine organisms are much moreadvanced than those of mammals because photosyntheticorganisms depend on solar irradiation as their primarysource of energy, and at the same time...
... collec-tion and refinement are summarized in Table 1. The program procheck [34] was used to analyse conforma-tional variations fromthe defined norms, with the quality of the Ramachandran plots [35] ... To accommodateK100 as a ligand a number of main-chain atoms aredisplaced relative to their positions in the wt structure.Although backbone deviations are detected at the startof the ligand ... the rearrangement of the ‘open’ and‘closed’ forms of the ligand loop [19]. Therefore, con-former A may be considered as the open form, albeit with the axial ligand still intact, withthe main-...
... in the databases. The two proteins migratingat 50 and 55 kDa (bands A and B; Fig. 1A) wereidentified from their N-terminal sequences as similar to a- amylase (accession no. AAA17751) from ... andanalysed by SDS/PAGE.Carboxypeptidase assays and expressionof HaCA42 mRNACarboxypeptidase assays using the synthetic substratesfurylacryloyl-Phe-Phe (FAPP), furylacryloyl-Ala-Lys(FAAK) ... of the procarboxypeptidase band at 50 kDahad been cleaved to 36 kDa and 13 kDa bands, but the carboxypeptidase activity was only 55% of the maximumactivity (Fig. 3A, B). The carboxypeptidase...
... of all the b Na-ScTxs from all the a Na-ScTxs. Thea Na-ScTxs have identities of the orderof 50% among themselves, the same being true for all the b Na-ScTxs (data not shown). However, when the ... constraints wereadded to the calculations. The dynamic annealing struc-ture calculations were performed withthe CNS softwaresuite [44].Analysis of Na+-channel sequencesBy searching data banks ... than the cardiac isoform rNaV1.5[67]). However, when the overall charge of both the toxinsand the channels are considered together, a plausibleexplanation comes from analysis of the other regioninvolved...
... GWMSKIASGIGTFLSGMQQaDRS B1 AMWKDVLKKIGTVALHAGKAALGAVADTISQaDRS B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAVaDRS B3 ALWKNMLKGIGKLAGQAALGAVKTLVGAEDRS B4 ALWKDILKNVGKAAGKAVLNTVTDMVNQaDRS B6 ALWKDILKNAGKAALNEINQLVNQaPBN2 ... 5Â-AGCATAACTGGAACGTGGG-3Â forcaerin 1.12, 5Â-CAGCAATAAGTGGAACAACG-3Â forcaerin 1.13, 5Â-GTGTTTAGCAACGGATTTACC-3Âfor caerin 1.14 and 5Â-AGCAACGGATCCTAGGACAC-3Â for caerin 1.15. The temperature ... isolatedIndia between 150 and 65 Ma and colonized the Laurasian land massafter India collided with Asia. Abbreviations; AF, Africa; IND, India;AUS, Australia; SA, South America; ANT, Antartica....
... humanfibrosarcoma and MCF 7 from human breast adenocarci-noma, were obtained fromthe Istituto ZooprofilatticoSperimentale della Lombardia e dell’Emilia, Brescia, Italy.Lipids. A series of natural and ... the 90 °polarizer, and S are order parameters calculated from the ratio of the parallel and perpendicular absorption bands. SLis for the lipid chains, derived fromthe symmetric andasymmetric ... LUVs.Similar aggregates appeared only very faintly in the absenceof lipids (Fig. 4A) . The rather long lag phase preceding fasthemolysis (Fig. 1A) may also indicate that the formation of a functional...