integration of modular abm components to simulate gut microbe interactions in a stressed environment
Báo cáo y học: " Relational grounding facilitates development of scientifically useful multiscale models" ppsx
... complicated but it can be accomplished by finding an appropriate time-scaling factor for all probability parameters Each of the scaling factors and/or parameters can be adjusted individually to obtain ... undergone validation against phenomena measured in context A may need to undergo considerable reengineering and reparameterization in order to validate against the altered phenomena measured in context ... or no quantitative data against which to validate In general, starting with a relational model allows us to progressively iterate from qualitative to quantitative validation With respect to this...
- 23
- 252
- 0
Five stories that are almost true, but not quite
... kept in shape because she was a classical dancer for a time and later became a fashion model She was cheery, always with a funny story or incident to relate and at all times fun to have around ... if that, finally, was good or bad luck It was the easy way out, that was certain, but as I walked slowly adding and subtracting the pros and cons, I did not manage to reach a conclusion Later, ... not intimidated and, I must say, her mother was always a pillar of support Anna was her one and only weakness I kissed both of them and it was obvious that my delight to see Anna again, was reciprocated...
- 11
- 460
- 0
Corporate Culture The Four Ingredients That Are Crucial to Your Company’s Success
... things to demonstrate professional management and expert leadership Key to his actions was to put profit into the value statements and strategic goals He also began to communicate the actual financial ... hundreds of management teams, and thousands of managers in management seminars These represented a cross-section of organizational levels and industries I asked the same question in at least ten ... lines to stay healthy This company is constantly adding to its product line to attract more customers A breakfast cereal company knows the jaded attitude of its markets and constantly seeks to...
- 34
- 529
- 0
Tài liệu Edit Data and Update Changes That Are Made to an ADO.NET pdf
... is created to create the Update command for the DataAdapter object The DataAdapter Update method is called to update the dataset with the data changed and then the AcceptChanges of the DataSet ... Create the LoadList routine by entering the following code into the form you created for this How -To This code creates and fills a data table using a data adapter The string that the data adapter ... Taking the SelectedItem from the list box, a data adapter is created, and a dataset is filled Next, the individual DataRow is created Last, each of the TextBox controls is loaded with the value...
- 10
- 400
- 0
Tài liệu Objects That Are Found in ADO.NET doc
... data Each data table has a default view, which is the starting data view that can be modified and stored in a separate data view DataRow This object enables you to manipulate the rows of data in ... the DataSet object, you can get overall relations, individual tables, rows, and columns DataTable One of the objects off of the data set, the DataTable object enables you to manipulate an individual ... that are returned by commands and the data adapters Unlike the recordset from ADO and DAO, the data set actually brings back a hierarchical view of the data Using properties and collections in...
- 5
- 325
- 0
Tài liệu Báo cáo khoa học: Analysis of oxidative events induced by expanded polyglutamine huntingtin exon 1 that are differentially restored by expression of heat shock proteins or treatment with an antioxidant ppt
... promotes the clearance of mutant protein by activating autophagy [18,19] Intracellular aggregates containing ubiquitylated proteins are a prominent cytopathologic feature of most neurodegenerative disorders ... repeats are toxic and precipitate as insoluble fibers in affected neurons [8] In human and HD transgenic mice, the disease correlates with the appearance of intraneuronal, intranuclear and perinuclear ... Firdaus et al downstream of the initiator ATG in exon (Ex1) of the 67 exon-containing htt gene [5] Pathogenesis in HD correlates with the cleavage of mutated htt and the release of an N-terminal...
- 18
- 721
- 0
Tài liệu Báo cáo khoa học: Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner pptx
... 14 Tomita, A. , Towatari, M., Tsuzuki, S., Hayakawa, F., Kosugi, H., Tamai, K., Miyazaki, T., Kinoshita, T & Saito, H (2000) c-Myb acetylation at the carboxyl-terminal conserved domain by transcriptional ... in the hematopoietic system [42] As shown in Fig 5, increasing amounts of transfected PIASy caused a parallel increase in the intensity of the retarded c-Myb species corresponding to single and ... total RNA was isolated Activation of the endogenous Myb-target gene, mim-1, was measured by real time PCR as described in Materials and methods Abbreviations are as above and also ÔAMV vMÕ, AMV...
- 11
- 556
- 0
Default Risk Cannot Explain the Muni Puzzle: Evidence from Municipal Bonds That Are Secured by U.S. Treasury Obligations ppt
... coefficient found in panel A However, panels A and B are not directly comparable because panel A includes several maturities that are not available in the Salomon data To facilitate a direct comparison ... tax rate Fama’s (1977) bank arbitrage model also predicts that Equation (1) should hold with τ equal to the top marginal corporate tax rate Fama argues that, because banks were legally able to ... spot rate estimates The asymptotic standard errors estimated in the CFI procedure are in general less than 10 basis points and in the majority of cases in the range of to basis points Finally, to...
- 28
- 591
- 0
Báo cáo khoa học: Cytosolic phospholipase A2-a and cyclooxygenase-2 localize to intracellular membranes of EA.hy.926 endothelial cells that are distinct from the endoplasmic reticulum and the Golgi apparatus pdf
... localization Several studies have also implied that cPLA2 -a may be regulated by cytoskeletal interactions Cytochalasin B, an inhibitor of actin polymerization, was shown to reduce collagen-induced arachidonic ... present in the digitonin-permeabilized cells, suggesting an association of cPLA2 -a with intranuclear membranous invaginations of the nuclear membrane [33] To further investigate the nuclear localization ... cPLA2 -a and convert arachidonic acid into prostaglandin H2 [8,9] To date, two distinct COX isoforms, COX-1 and COX-2, have been identified and characterized, and an alternative splice variant of...
- 13
- 387
- 0
Easy Recipes that are Gluten-Fre pptx
... well and leave to stand for hours Add egg and basil to the mixed meat and mix well Spoon into a large (2 lb) loaf tin, smoothing the surface Top with bay leaves Set in a roasting tin and add water ... turkey mince in a saucepan Add the tomato mix to the turkey and mix together Serve over a bed of mixed salad leaves CHECK ALL ingredient labels EVERY TIME YOU BUY SALADS: MAIN COURSE - VEGETARIAN ... vinegar tblsp water tsp dried basil a pinch of dried oregano ½ tsp sugar salt and pepper to taste Cut tomatoes into 2cm chunks Slice onions and mushrooms In a large bowl mix oil, vinegar, water,...
- 25
- 940
- 0
Authoring and Generating Health-Education Documents That Are Tailored to the Needs of the Individual Patient doc
... relevant to the particular patient Representing a Tailorable Document 3.1 Finding an Appropriate Level of Abstraction As explained above, a master document is a specification of all the information ... the benefits and risks of hormone-replacement therapy needs to take into account a large number of interacting factors in her medical history and that of her family In such cases, tailored documents ... to later Fortunately, in such clinical situations, much of the information that is needed for tailoring health-education material is available in the patient’s medical record Indeed, a medical...
- 12
- 379
- 0
Báo cáo khoa học: A profile of the residues in the second extracellular loop that are critical for ligand recognition of human prostacyclin receptor pdf
... domain of the human thromboxane A2 receptor allows discrimination between agonist and antagonist binding sites Mol Pharmacol 44, 934–939 20 Yamamoto Y, Kamiya K & Terao S (1993) Modeling of human ... that S168T retained its ligand-binding activity cannot exclude the possibility that S168 in IP and S181 in TP lead to differences from other prostanoids containing Thr as their standard amino acid ... DpnI endonuclease were obtained from Stratagene (La Jolla, CA, USA) Rabbit anti-(human IP) serum was purchased from Cayman Chemical (Ann Arbor, MI, USA) Prostacyclin receptor structure and function...
- 10
- 354
- 0
Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx
... Data Multiple protocols 26 Multiple protocols (encapsulated) HTTP Header Protocols Frame Header IP Header Data App TCP Header Header Frame Trailer Data Encapsulation – Process of adding a header ... setup and termination of data transfer sessions 25 Message uses Multiple protocols (encapsulated) HTTP Header Protocols Frame Header IP Header Data App TCP Header Header Frame Trailer Data Message: ... The amount of data and the speed at which it must be transmitted – The cost of the media and installation 17 Local Area Network (LAN) Local Area Network (LAN) An individual network usually spans...
- 52
- 550
- 0
Chapter 3: Financial Audit Receivables and Payables Activities between funds that are ppt
... 2003 was as follows: Beginning Balance Governmental activities: Capital assets not being depreciated: Land Total capital assets not being depreciated $ Capital assets being depreciated: Land improvements ... have a material adverse effect on the financial position of the department, because any judgments against the department are judgments against the State, and would have to be paid by legislative ... legislative appropriation of the state general fund and not by the department Ceded Land The Office of Hawaiian Affairs (OHA) and the State are presently in litigation involving the State’s alleged failure...
- 10
- 277
- 0
Báo cáo toán học: "On identifying codes in the king grid that are robust against edge deletions" potx
... different vertices are adjacent if their Euclidean distance is at most The king grid is a mathematically attractive model, because a ball of radius r has a particularly simple form, being a (2r + 1) ... as required, as can be seen using an argument similar to the one in the proof of Theorem (recall that whenever Lemma guarantees three disjoint paths to a codeword not all of them can be cut by ... code in the king lattice, Discrete Math 276 (2004), pp 95–109 [5] I Charon, O Hudry and A Lobstein, Extremal cardinalities for identifying and locating-dominating codes in graphs, Discrete Math.,...
- 13
- 213
- 0
Báo cáo y học: " Strand-specific RNA sequencing reveals extensive regulated long antisense transcripts that are conserved across yeast specie" ppt
... using the following primers: GTAAAAGTATTTGGCTTCATTAG TGTGTGAAAAATAAAGAAAATAGATACAATACTATCGACGGTCGACGGATCCCCGGGTT and AAGA AAGTATATAAAATCTCTCTATATTATACAGGCTACTTCTTTTAGGAAACGTCACATCGATGAATTCGAGCTCGTT ... effectors HSP31 and GRE2) Thus, antisense regulation may play a regulatory role at coordinating the major metabolic changes in the diauxic shift and early stationary phase, and some of the changes ... (Qiagen - Valencia, CA, USA) and 500 ng of total RNA Each reaction was carried out at 50°C for 20 minutes, and heat inactivated at 70°C for 15 minutes PCR was conducted as for the S cerevisiae...
- 14
- 339
- 0
Báo cáo y học: "APOBEC3G induces a hypermutation gradient: purifying selection at multiple steps during HIV-1 replication results in levels of G-to-A mutations that are high in DNA, intermediate in cellular viral RNA, and low in virion RNA" pps
... C-terminal portion of Vif was amplified using the forward primer YRHHYmutF, 5'GGAAAGCTAAGGACTGGT TTGCTGCAGCTGCCGCTGAAAGTACTAATCCAAAAATA AG3', and the reverse primer VifR, 5'GGATAAACAGCAGT TGTTGC3' ... indicated that purifying selection pressure was operating against genomes that had inactivating mutations in the gag gene The observation that a few of the viral RNA-derived sequences had inactivating ... t-test assuming equal variance with a one-tailed analysis (H) Graphical representation of the type of G -to- A mutations observed in each individual clone in the proviral DNA, the cRNA, and the vRNA...
- 15
- 320
- 0
Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx
... LQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGSHLTGLLAVAVLAFTWTS LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL LQKHFRCQCYLGWGGEQCQRNYKGAAGNASRAWAGSHLTSLLGLVAVALTWTL LQMHFRCHCYLGWGGEQCQWNHKRAAGDASRAWAGAHLASLLGLVAMTLTWTL ... from that of human Hyal2 We also made a human Hyal2 mutant that contained all three of these mutations, and this mutant had 6% of the activity of human Hyal2 (average of two experiments, data not ... chimeric, and mutant receptors, analyzed the data, and drafted the manuscript All authors read and approved the final manuscript Additional material Additional File "Hyal2 DNA sequences.fasta" Bovine...
- 11
- 247
- 0
Báo cáo sinh học: "Genetic diversity of selected genes that are potentially economically important in feral sheep of New Zealand" pot
... Arapawa Island I Australia/Merino/unknown 17 Arapawa Island II Australia/Merino/unknown 61 Chatham Island Australia/Merinos/Saxon 22 Pitt Island Australia/Merinos/Saxon 519 Campbell Island Australia/Merino ... mainland have been able to maintain genetic diversity, especially because the flocks sizes are small compared to the original populations Allele sharing among four offshore island flocks (Arapawa ... 01011401 1201 Arapawa Island I 17 0.1 8a - 0.1 5a - 0.0 6a 0.0 6a - - 0.0 3a a a a a Arapawa Island II 61 0.02 0.02 - - - - 0.03 0.17 Chatham Island 22 0.2 3a - - 0.0 5a - 0.0 9a - - - Pitt Island 519 13...
- 8
- 275
- 0
Báo cáo y học: "Summary The claudin multigene family encodes tetraspan membrane proteins that are crucial structural and functional components of tight junctions, which have important roles in regulating para cellular" pdf
... Claudin-4 Claudin-1 8a Claudin-3 Claudin-18b Claudin-20 Claudin-12 Claudin-14 Claudin-2 Claudin-19b Claudin-1 9a Claudin-16 Claudin-7 Claudin-1 Claudin-21 Claudin-24 Claudin-22 Claudin-23 Figure A ... Nag and Morin: Genome Biology 2009, 10:235 235.4 Claudin-1 0a Claudin-8 Claudin-17 Claudin-5 ‘Classic’ claudins ‘Non-classic’ claudins Claudin-10b Claudin-15 Claudin-9 Claudin-11 Claudin-6 Claudin-4 ... [18], although it appears that heterotypic headto-head interactions between claudins belonging to two different membranes are limited to certain combinations of claudins [19] Localization and function...
- 7
- 348
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008