... identified immediately upon the introduction of methicillin into clinical practice Methicillin-resistant S aureus (MRSA) was initially identified for the first time in 1961 by Jevons [25,26] Since ... methicillin-resistant and methicillin-sensitive coagulase-negative staphylococcal clinical and carrier Isolates resistance to these three antibiotics after transformation of plasmid pJMR-10 into ... zero resistance to amikacin was seen Comparative multi-drug resistance patterns of methicillinresistant and methicillin-sensitive clinical and carrier isolates Resistance to antibiotics or more...
... these thresholds While discretization of a continuous variable inevitably results in a loss of statistical information(Morgan and Elashoff 1987), this is practically difficult to avoid in a trial ... thesis allows the scientific community investigating RCC to prepare its labours with a firm foundation from a clear understanding of the molecularepidemiologyand pathology of RCC viii LIST OF ... significantly in terms of all outcomes, while addition of the Leibovich trial criteria to the Karakiewicz nomogram classification did not yield any benefits This is true for both the semi-continuous...
... or Inc typing in the 1970s (8) Incompatibility typing classifies plasmids by their ability to stably coexist with other plasmids in the same bacterial strain Incompatibility is defined as the inability ... field into perspective, with its promises fulfilled or let down, its practical implications in terms of public health, its unsolved challenges, and its future potential with the burgeoning of ... patient care remains limited and mainly consists of species identification using PCR techniques, which is still limited to specialized laboratories Where strain typing (i. e., characterization at the...
... and achievements 1.3.1 Definition ofmolecularepidemiologyof TB Molecularepidemiology is a field that has emerged from the integration ofmolecular biology, clinical medicine, statistics and ... difference in lineage distribution between samples collected in hospitals at national level and in hospitals at lower levels The hypothesis of evolution of TB molecularepidemiology in Vietnam Hue is ... susceptibility testing Drug susceptibility of M tuberculosis isolates was determined by Canetti-Grosset proportion test 2.2.5.4 Spoligotyping Spoligotyping was done following the international standard...
... AML ALL End Stage Renal Failure AML ALL ALL NHL Line Line Line Line Line Line Line Cellulitis Pneumonia Line Line Febrile neutropenia Line-related abscess Line Line Line Line Line Line Line Line ... tissue infection and there is evidence that its incidence is increasing [1] Optimizing the antimicrobial treatment of S maltophilia infection is challenging because S maltophilia is inherently ... Line-associated Febrile neutropenia Pneumonia Skin soft tissue infection Polymicrobial Treatment of line infection Line removal Antimicrobial therapy Cotrimoxazole Outcome Death Death attributed to...
... involvement of HTLV- I infection in arthritis Our results showed that C-PTHrP, sIL-2R and IL-6 were significantly higher in SF of HTLV- I carriers than in that of HTLV- I- negative OA patients Furthermore, ... with hyperaemic dilated vessels and mild lymphocytic infiltration Unlike in rheumatoid arthritis, however, neither stratified synovial lining cells nor lymphoid follicle formation were evident ... subtle or minimal (Table 2) In contrast, the two synovia of IgM-positive patients consisted, in part, of papillary projected synovium with synovial lining cells stratified into more than five layers...
... licensee BioMed Central Ltd This is an Open Access article distributed under the terms of the Creative Commons Attribution ArticleCopyright : License, which permits unrestricted use, distribution, and ... neighboring provinces, the municipality, as a major industrial and commercial center, is deserving of close attention with respect to HEV infection epidemiology A total of 60 sequences located within ... analyzed sufficiently and the possibility that human subtype 4b exists among the population of the municipality cannot be excluded Genotype HEV strains were geographically limited to Shanghai and...
... genetic distances, and the reliability of the tree was tested by bootstrap analysis with 1,000 replications For the ML Table 1: Details of 22 strains of JEV from South Korea* Strain Year Source Location ... K95A07, and K01JN and K01-JB) were identical, despite differences in their geographic distributions and the maximum five-year time span This genetic stability in JEV was also detected in strains ... encephalitis virus in Taiwan Am J Trop Med Hyg 2000, 62:446-452 Williams DT, Wang LF, Daniels PW, Mackenzie JS: Molecular characterization of the first Australian isolate of Japanese encephalitis virus,...
... serine to proline substitution at position 206 to be associated with the appearance of a cytopathic effect [15] The in vivo significance of this substitution remains unclear It was only possible ... epidemiological investigations on agent origin and spread Acknowledgements The authors would like to thank Hilde Sindre, National Veterinary Institute Oslo, for scientific discussion on the contents ... recently studied Norwegian Atlantic salmon sites affected by PD [9], the two sequences obtained from the study site with the highest mortality (site 2, Table 1: 26.9%) did not show this substitution...
... characteristic, possible mode of transmission, area/district, and estimated time of infection along with complete address and contact numbers of the patients HCV RNA qualitative and quantitative PCRs ... respectively Specimens yielding values above the upper limit were diluted 100-fold, retested and the obtained values were multiplied by this dilution factor to get the actual HCV RNA concentration ... demographic distribution of HCV patients genotyped are summarized in figure The figure also show enrolment and disposition criteria of the patients The results revealed that out of total 663 antiHCV...
... vertical transmission, it appears that the potential of perinatal HBV transmission in India is similar to Africa but lower than that in East Asia It has been estimated that HBV infection is largely ... manifestations and also in studying the importance of clinically relevant mutants in this population In the eastern part of India, despite high prevalence of chronic HBV infection and distribution ... India, (ii) identify possible routes of introduction of HBV genotype C in Eastern India, (iii) analyze the HBV x gene variability and its implications in Eastern Indian HBV carriers, (iv) determine...
... residue indicating that this position is critical for Tax 2A activity Lor L6 , which contains all the mutations found in Lor except for W248R, failed to activate the LTR while displaying wildtype ... L8 7I, and P9 2L substantially reduced the ability of Mo to transactivate the LTR and without affecting NFkB activity (Table 3) Analysis of the subcellular location of mutant proteins in Cos cells ... a similar intra cellular distribution as Mo and Tax 2B (Figure 2) These results clearly indicate that the sub cellular distribution of Lor or Gar was not contributing to their loss of activity...
... Export Signal NES HTLV- 4(1863LE) HTLV- 2(MoT) HTLV- 2(Efe) STLV- 2 (PP1 664) HTLV- 1(ATK) HTLV- 3(2026ND) STLV- 3(TGE2117) HTGAIIILPEDALPTTLFQPVRAPCVQTTWNTGLLPYQPNLTTPGLIWTFNDGSPMISGPCPKAGQPSLVVQSSLLIFERFQTKAYHPSYLLSHQLIQYS ... were potent inhibitors of Tax induction ofHTLV LTR activity with similar cellular localizations like that of the HTLV- 1 HBZ (unpublished data) These results not only confirm the predicted HBZ ... 72.1% similarity of the HTLV- 1 and HTLV- 3 SUs to K55, respectively, allowing serologic discrimination of HTLV- 2 from HTLV- 1 in this region In contrast, the HTLV- 4(1863LE), HTLV- 2, and HTLV- 3 SUs...
... MKTLLLTLVVVTIVCLDLGYT MKTLLLTLVVVTIVCLDLGYT MKTLLLTLVVVTIVCLDLGYT MKTLLLTLVVVTIVCLDLGYT MKTLLLTLVVVTIVCLELGYT MKTLLLTLVVLTIVCLDLGHT a Could not be isolated from both KBf venoms 516 FEBS Journal ... 8.9 4.8 MYPAHLLVLLAVCVSLLGAANIPPQPL MYPAHLLVLLAVCVSLLGAANIPPQPL MYPAHLLVLLAVCVSLLGAANIPPQSL MYPAHLLVLLAVCVSLLGAANIPPQSL ND MYPAHLLVLLAVCVSLLGAANIPPQPL MYPAHLLVLLAVCVSLLGAS I IPPQPL 6455 6401 7421 ... are all basic PLAs present in relatively high content and retain interfacial or membrane binding properties in spite of the low catalytic activities In fact, many of the inactive Lys49 PLAs from...
... sites are also in disequilibrium with one another In contrast, squares linking site with all other sites are white or light yellow and these sites are in equilibrium with site The majority of ... suggests a very high nucleotide substitution rate but a very low rate of amino acid substitutions This pattern is consistent with strong purifying selection To test this pattern further, the F* statistic ... infectivity, stability, persistence, host adaptability, replication, or otherwise These combinations of events are random, or at least not predictable at this time, and therefore continued surveillance...
... sites are also in disequilibrium with one another In contrast, squares linking site with all other sites are white or light yellow and these sites are in equilibrium with site The majority of ... suggests a very high nucleotide substitution rate but a very low rate of amino acid substitutions This pattern is consistent with strong purifying selection To test this pattern further, the F* statistic ... infectivity, stability, persistence, host adaptability, replication, or otherwise These combinations of events are random, or at least not predictable at this time, and therefore continued surveillance...
... it And finally, GOD for all his blessings! II TABLE OF CONTENTS Page CONTENTS Declaration page I Acknowledgements II Table of contents III Publications, presentations, awards VII Summary VIII ... Influenza surveillance Detection of institutionalized outbreaks Co-cultured cells support growth of multiple respiratory viruses Clinical management Influenza surveillance Detection of institutionalized ... production Antigenic characterization Detection of novel influenza strain Influenza surveillance Detection of institutionalized outbreaks Monitor antiviral resistance Documents active infection Influenza...
... non-select population of medicalsurgical critically ill patients It is also the first study to attempt to characterise the longitudinal nature of sodium disturbances with a time-dependent data set ... mortality Our study provides three important contributions to the epidemiologyof sodium disturbances in critically ill patients in addition to the previously published works by Polderman and ... publicly funded hospital care to the residents of the city of Calgary and surrounding areas (population 1.2 million) in the province of Alberta, Canada [14] All critically ill adult patients in the...
... trend towards higher LDL in the group of C allele carriers but with this was not statistically significant However patients carrying the C allele presented a significantly lower VLDL In the entire ... separately but did not present statistically significant results (data not shown) HDL plasma levels are inversely related to BMI Thus potential associations of PPARδ with HDL-C levels could be ... alleles as described [10] The longer primer for detection of the wt allele was 5’-TTC AAG CCC TGA TGA TAA GGT CTT TGG CAT TAG ATG CTG TTT TGT TTT-3.’ The shorter primer was 5’-CTT TTG GCA TTA...
... short, immobilized oligonucleotides attached as parallel lines on nitrocellulose membrane strips, permitting easy identification of wild-type virus or mutant variants For this purpose, biotinylated, ... Automatability interpretation intensiveness intermediate intermediate low intermediate intermediate high Intermediate high high low low intermediate intermediate low yes no no yes yes yes yes low ... challenge is the integration of HBV diagnostic testing with new therapeutic agents in order to ensure optimized, tailored patient treatment Such integrated HBV diagnostic and treatment strategies will...