equations with kernel of the form k ••••••••••••••••••••••••• x t m 1
Tài liệu Báo cáo khoa học: Arabidopsis thaliana BTB⁄ POZ-MATH proteins interact with members of the ERF⁄AP2 transcription factor family ppt
... even to a subset of eight members The finding that, within the A-6 subfamily, not all of its members interact with BPM1 indicates that BPM proteins assemble only with a very limited set of ERF ... assembly with BPM proteins, we decided to test At1g65050 This protein has no BTB motif, but contains a MATH domain that is most closely related to those from BPMs [30] In these experiments, BPM 11 18 9 ... C Fig Mapping of the interactive sites in BPM1 and RAP2.4 (A) In vitro-translated BPM1 (1 15 1) can interact with GST:RAP2.4 (B) Schematic drawing of BPM1 The triangle indicates the fragment used...
- 12
- 657
- 0
A Brief Memoir with Portions of the Diary, Letters, and Other Remains, potx
... them to? is a question not enough thought of One wishes them to be gathered to the Church of England, another to the Church of Scotland; but I am persuaded their gathering must be to the primitive ... yet known 1st Mo 19 th Some earnest desires last evening, this morning, and in the night, to be set right in spirit Struck with the text, "His countenance doth behold the upright," not that the ... must ever be a mystery to his intellectual nature, for it is above it._ There is a natural testimony to the supremacy of the moral in man above the intellectual 10 th Mo 8th The charm of book and...
- 95
- 517
- 0
báo cáo hóa học:" Validation of the Individualised Neuromuscular Quality Of Life for the USA with comparison of the impact of muscle disease on those living in USA versus UK" doc
... Descriptive data for domain scores from United Kingdom (UK) and United States of America (US) Extent column: Extent of Impact (minimum and maximum 5); Importance column: Importance of impact (minimum ... helped me to get through the most difficult times.” – UK patient “My family & friends are very supportive of my MD in that they help with stairs, getting up from chairs etc.” – US patient The themes ... relating to emotions and other psychological issues were very much intertwined and respondents tended to comment upon the emotional impact of MD in the context of the other life domains For example,...
- 38
- 391
- 0
Báo cáo hóa học: " Research Article Regularity Criterion for Weak Solutions to the Navier-Stokes Equations in Terms of the Gradient of the Pressure" docx
... position to complete the proof of Theorem 1. 2 From Proposition 2 .1, it follows that there exists T ∗ > and the smooth solution v of 1. 1 – 1. 3 satisfies v t ∈ L∞ ∩ C 0, T ∗ ; L4 , v u0 2.5 Since the ... Leray weak solution of 1. 1 – 1. 3 in 0, T If the gradient of the pressure satisfies the condition ∇π ∈ L2/3 0, T ; BMO , 1. 15 then u is smooth in 0, T Remark 1. 3 If the interpolation inequality u ... T Without loss of ∗ generality, we may assume that T is the maximal existence time for v t By Proposition 2 .1 again, we find that u t L4 ≥ C T − t 1/ 8 for any t ∈ 0, T ∗ 2.7 On the other hand,...
- 6
- 435
- 0
Báo cáo hóa học: " Research Article Existence and Multiplicity Results for Degenerate Elliptic Equations with Dependence on the Gradient" docx
... inequalities, we have that Ω |∇u |m ≤ c0 Ω u p +1 + M1 Ω |∇u|α u + Ω |∇u|β u α /m (p +1) /m ≤C Ω |∇u |m + M1 β /m + M1 Ω |∇u |m Ω Ω |∇u |m um/ (m β) Ω |∇u |m (m α) /m (m β) /m (p +1) /m ≤C Ω um/ (m α) (α +1) /m + C1 ... Lemma 3 .1, we obtain that C ∩ ({0} × C (Ω)) = (0,0) Therefore, we have a positive solution u to the problem (P)0 Acknowledgments The first author would like to thank the hospitality of Departamento ... following Theorem 1. 1 Let u ∈ C (Ω) be a positive solution of problem (P)τ Suppose that the conditions (H1 )–(H4 ) and the hypotheses (A1 )–(A3 ) are satisfied with γ = m( q − p)/ (1 − m + p) Then, there...
- 12
- 266
- 0
báo cáo khoa học: "Primary malignant mixed müllerian tumor of the peritoneum a case report with review of the literature" doc
... median postoperative survival time being 14 months Due to the rarity of the disease, limited data regarding the management of peritoneal MMMT exist Treatment modalities include surgery, chemotherapy ... suggested that although most carcinosarcomas are combination tumors, some develop as collision tumors The morphology of the present tumor is consistent with malignant mixed M llerian tumor The epithelial ... with strong immunoreactivity of the epithelial and mesenchymal cells (× 400) Page of examination of the uterus and adnexae Furthermore, absence of calretinin expression suggested that the tumor...
- 4
- 461
- 0
báo cáo khoa học: "Aspergilloma in combination with adenocarcinoma of the lung" ppt
... contributions MS conceptualized the case study, gathered the data and wrote the manuscript M Serraj interpreted the data and revised the manuscript YO acquired the data LC performed the histopathological ... fungus ball-like shadow is fixed to a thick and irregular wall of the cavity and its position is not altered with the patient’s movements [5] and particularly in case of preexisting factor of lung ... evaluation and interpretation of the data KZ performed the histopathological evaluation and interpretation of the data AA gave final approval for publication All authors read and approved the final...
- 3
- 244
- 0
Báo cáo khoa học: "Gallbladder perforation associated with carcinoma of the duodenal papilla: a case report" pdf
... declare that they have no competing interests Authors' contributions AH participated in the treatment of the patient, collection of case details, literature search and drafted the manuscript MN, KS, ... specimens demonstrated well-differentiated tubular adenocarcinoma with a maximum diameter of 1. 3 cm localized in the papilla, with no lymph node metastasis, classifying the tumor as TNM stage ... in about 10 % of patients with a pT1 carcinoma of the papilla Therefore, Kausch-Whipple procedure or PPPD with lymph node dissection is the first choice of treatment even in patients with localized...
- 3
- 312
- 0
Báo cáo khoa học: "Malignant gastrointestinal stromal tumor presenting with hemoperitoneum in puerperium: report of a case with review of the literature" ppt
... period and the fetal growth was within the normal limits as well, according to the patient’s information She had a normal delivery at term at a Private Maternity Hospital of Athens The patient denied ... findings The symptomatic GISTs of the esophagus typically present with dysphagia Gastric and small intestinal GISTs Figure Immunohistochemical staining of the tumor tissue demonstrated strongly positive ... performed, removing the tumor with a part of 3-cm of the small intestine (Figure 4) The abdominal cavity was irrigated and carefully inspected; the omentum, the ovaries and the uterus had normal macroscopic...
- 7
- 457
- 0
Báo cáo lâm nghiệp: "Influence of the form of nitrogen nutrition reductase activity in young black locus" doc
... concomitant with the advent of the N activity, indicates a relationship ase between both enzyme activities The low NR activity ( !1 nmol N0 DW!h-!) of -mg2 nodulated plants could be greatly increased ... Effect of nitrate of leaf NR activity of nodulafed plants Administration of mM NaN0 to 11 mo old nodulated plants did not increase leaf NR activity, whereas the 10 mM NaN0 dose induced high enzyme ... expanded, the NR activity decreased in the previous leaf and the highest enzyme activity was found again in the new leaf (Fig 2) When the nitrate supply was withdrawn, the enzyme activity recovered its...
- 4
- 202
- 0
Báo cáo khoa học: " Intensity modulated radiotherapy (IMRT) in patients with carcinomas of the paranasal sinuses: clinical benefit for complex shaped target volumes" ppsx
... furthermore, RT is associated with a high risk of treatment-related toxicity [15 -17 ] In the past, chronic toxicity to the optic system was of major concern, with RTinduced blindness rates of ... patients were staged according to the 2002 TNM classification system [ 21] Five patients presented with T1 / T2 tumors, 11 with T3 and 30 patients with T4 tumors, respectively Six patients (13 %) ... short follow-up time The present study retrospectively evaluates the results of IMRT in 46 patients with carcinomas of the PNS, with special respect to treatment related acute and chronic toxicity...
- 8
- 617
- 0
Hysteresis Voltage Control of DVR Based on Unipolar PWM 95 With comparison of the obtained results docx
... coupling transformer The regulation on the magnitude of the StatCom's output voltage, gives rise to the reactive power exchange between the StatCom and the transmission system The StatCom's basic structure ... Capability Benefit Margin (CBM), and the Existing Transmission Commitments (ETC) The real power transfer at the first security violation excluding existing transmission commitments is the total TTC TRM ... harmonic instabilities The improvement of the developed models to include the effect the filter capacitance on the harmonic performance of the inverter is an interesting improvement Reviews of the...
- 53
- 434
- 0
Báo cáo khoa hoc:"Effect of the slow (K) or rapid (k +) feathering gene on body and feather growth and fatness according to ambient temperature in a Leghorn × brown egg type cross" ppsx
... not to influence their performances; moreover the absence of significant effect of temperature and interaction with genotype suggests that the environment acts similarly on the expression of the ... significant effect of temperature on these variables at 10 weeks These results show on the contrary that the genotype had no effect on the weight of feathers, neither in absolute terms nor in per cent ... showed that the two genotypes have not had the same expression at all ages This fact is not explained to date It would be interesting to study the effects of the K gene at ages from to weeks and at...
- 12
- 344
- 0
Báo cáo y học: "Surgical fasciectomy of the trapezius muscle combined with neurolysis of the Spinal accessory nerve; results and long-term follow-up in 30 consecutive cases of refractory chronic whiplash" pps
... 27-66) The mean and median time from the onset of symptoms until surgery was 41 months (range 7 -15 6) and 24 months, respectively All of the patients stated that their condition had reached a steady ... not report any benefit from the operation, noting that her condition was unchanged Another patient reported increased stiffness after the operation, but at the same time noted that three other ... steady state at the time of the operation Fourteen patients reported that their condition had been precipitated by a classic rear-impact motor vehicle crash The remaining 16 patients reported various...
- 6
- 361
- 0
báo cáo khoa học: "Osteoarthritis of the talonavicular joint with pseudarthrosis of the navicular bone: a case report " pps
... arthrodesis in patients with traumatic arthritis [3, 6] Most of the literature addresses patients with either inflammatory arthritis or adult acquired flat foot [4, 5, 7 -11 ] Main reported that ... Primary fusion of the talonavicular joint after fracture dislocation of the navicular bone J Trauma 19 98, 45 :11 00 -11 02 Kindsfater K, Wilson MG, Thomas WH: Management of the rheumatoid hindfoot with ... competing interests Authors' contributions NK performed the surgical procedure, examined the case file, reviewed the literature and made major contributions to the writing of the manuscript TN,...
- 14
- 281
- 0
Báo cáo y học: "Epithelioid hemangioma (angiolymphoid hyperplasia with eosinophilia) of the orbit: a case report" pdf
... into the lumen is the most important discriminator in establishing the diagnosis of EH Such distinction is crucial for the patient because EH is not associated with any of the systemic manifestations ... Presentation An eighteen year-old Asian female presented to the ophthalmology clinic of the McGill University Health Center with a three-month history of fluctuating swelling and ptosis of the left ... hemangioendothelioma: a vascular tumor often mistaken for a carcinoma Cancer 19 82, 50(5):970-9 81 McEachren TM, Brownstein S, Jordan DR, Montpetit VA, Font RL: Epithelioid hemangioma of the orbit Ophthalmology...
- 4
- 348
- 0
Báo cáo y học: "“Floating arm” injury in a child with fractures of the proximal and distal parts of the humerus: a case report" docx
... limb A mm temporary Kirschner wire was inserted to the humeral shaft from the lateral to medial direction With the assistance of this “joystick” Kirschner wire, the humeral shaft was manipulated ... fracture of the ipsilateral upper extremity and termed this injury as “floating forearm” Similarly, we prefer the term “floating arm” to describe this rare combination of the fractures at the ... “joystick” Competing interests The authors declare that they have no competing interests Consent Written informed consent was obtained from the patient’s parents for publication of this case report and...
- 4
- 409
- 0
Báo cáo y học: " Breast conserving surgery with preservation of the nipple-areola complex as a feasible and safe approach in male breast cancer: a case report" pptx
... in those patients with metastatic disease and, therefore, Tamoxifen has been incorporated in the treatment of MBC [2,3,5 ,11 ] There is not sufficient evidence for the use of aromatase inhibitors ... patient SL wrote the paper with the assistance of GF RAM reviewed and edited the initial manuscript DJH performed the initial operation, and organised the primary management plan of the patient ... declare that they have no competing interests http://www.jmedicalcasereports.com/content/2 /1/ 126 11 12 13 14 15 Ribeiro G, Swindell R: Adjuvant tamoxifen for male breast cancer (MBC) Br J Cancer 19 92,...
- 3
- 275
- 0
báo cáo khoa học:" Validation of the Individualised Neuromuscular Quality Of Life for the USA with comparison of the impact of muscle disease on those living in USA versus UK" doc
... questionnaire, meaning that the mean difficulty of the items does not effectively match the mean ability of the participants Thus, by removing the most able participants from the analysis the targeting, ... All patients consented to partaking in the study The study adhered to the tenets of the declaration of Helsinki Quality of life outcome measures Impact of Vision Impairment (IVI) The IVI questionnaire ... of total variation attributable to the factor, partialling out (excluding) other factors from the total nonerror variation.[32] Twenty-eight patients were removed from the final analyses as they...
- 22
- 484
- 0
báo cáo khoa học: " An R2R3 MYB transcription factor associated with regulation of the anthocyanin biosynthetic pathway in Rosaceae" pptx
... Rosa_MYB10VRKGAWTREEDXLLRQXIEXXGEGKWXXVXXXAGLXRCRKSCRXRWLNYLKPNIKRGDFXEDEVDLIIRLHKLLGNRWSLIAXRLPGRTANXVKNYWNTXXXXXX Antho_MYBsVRKGXWTXEEDXLLRXCIXXXGEGKWXXVXXXAGLXRCRKSCRXRWLNYLKPXIKRGXFXXDEVDLIIRLHKLLGNRWSLIAXRLPGRTANXVKNYWXXXXXXXX Other_MYBsLKKGPWTPEEDEKLISYIXXHGEGNWRSLPKKAGLXRCGKSCRLRWINYLRPDIKRGNFTEEEEELIIXLHALLGNRWSXIARHLPGRTDNEIKNYWNTHLKKKL ... et al BMC Plant Biology 2 010 , 10 :50 http://www.biomedcentral.com /14 71- 2229 /10 /50 conjunction with the promoters of structural genes [13 ] For example, the R2R3 MYB C1 protein, that regulates the ... Biology 2 010 , 10 :50 http://www.biomedcentral.com /14 71- 2229 /10 /50 Page of 17 A 10 20 30 40 50 60 70 80 90 10 0 Rosa_MYB10VRKGAWTREEDXLLRQXIEXXGEGKWXXVXXXAGLXRCRKSCRXRWLNYLKPNIKRGDFXEDEVDLIIRLHKLLGNRWSLIAXRLPGRTANXVKNYWNTXXXXXX...
- 17
- 332
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu