compare b with a given confidence level alpha 5 1 0 5 or 0 1
Báo cáo toán học: "The order of monochromatic subgraphs with a given minimum degree" doc
... Voxman, Either a graph or its complement is connected : A continuing saga, Mathematics Magazine, to appear [3] D W Matula, Ramsey Theory for graph connectivity, J Graph Theory (19 83), 95- 1 05 the ... journal of combinatorics 10 ( 200 3), #R32 [4] Y Caro and Y Roditty, Connected colorings of graphs, Ars Combinatoria, to appear [5] Y Caro and R Yuster, Edge coloring complete uniform hypergraphs with ... vertices and more than (k − 1) m − k edges contains a k-subgraph Furthermore, there are graphs with m vertices and (k − 1) m − k edges that have no k-subgraph the electronic journal of combinatorics 10 ...
- 8
- 310
- 0
Báo cáo toán học: "The maximum number of perfect matchings in graphs with a given degree sequence" docx
... graphs, arXiv: 08 03 .08 64v1, March 200 8 [4] H Minc, Upper bounds for permanents of (0, 1) -matrices, Bull Amer Math Soc 69 (19 63), 789-7 91 the electronic journal of combinatorics 15 ( 200 8), #N13 ... Let A be an n × n (0, 1) matrix, i.e A = [aij ]n Denote ri = n aij , i = i,j =1 ∈ {0, 1} j =1 1, , n The celebrated Bregman-Minc inequality, conjectured by Minc [4] and proved by Bregman [1] , ... (2 .1) , and no ri is zero Therefore, after permuting the rows and columns of the adjacency matrix of G it is a block diagonal matrix in which every block is an all -1 square matrix, and as our graph...
- 2
- 367
- 0
Báo cáo toán học: "On the number of subsequences with a given sum in a finite abelian grou" pptx
... #P133 E(Sa 1 ), that is, {0, a1 , , (k − 1) ( a1 )} ⊆ E(Sa 1 ) but k( a1 ) ∈ E(Sa 1 ) Then, / 1 1 1 N(k 1) ( a1 ) (Sa 1 ) = 2|Sa1 |−D(G) +1 but Nk( a1 ) (Sa 1 ) = 2|Sa1 |−D(G) +1 Thus, 1 N(k 1) ( a1 ... subsequence T1 of S and a term a1 |T1 By Lemma 5, ∈ E(S) ⊆ E(Sa 1 ) By (iv), a1 ⊆ E(Sa 1 ) Let k be the minimum index such that k( a1 ) ∈ / 1 the electronic journal of combinatorics 18 (2 01 1 ), ... Ordaz, Representation of finite abelian group elements by subsequence sums, J Theor Nombres Bordeaux 21 ( 200 9), 55 9 58 7 the electronic journal of combinatorics 18 (2 01 1 ), #P133 [18 ] D.R Guichard,...
- 10
- 360
- 0
báo cáo hóa học: " Too much or too little step width variability is associated with a fall history in older persons who walk at or near normal gait speed" pdf
... 80. 3 (5. 1) 15 5 .0 (32.4) 16 3 .0 (9 .0) 26 (32 .1) 20 (24.7) 58 ( 71. 6) 02 96 18 56 80 03 0. 21 ( .04 ) 0 .57 (0. 09) 0. 73 (0. 09) 0 .56 (0. 06) 1. 03 (0. 21) 0. 22 (0. 04) 0 .57 (0. 09) 0. 73 (0. 09) 0 .56 (0. 06) 1. 04 ... (1. 37, 5. 31) 1. 08 (1. 02 , 1. 14) 55 (.33, 93) 2.76 (1. 40, 5. 45) 1. 08 (1. 02 , 1. 15 ) 51 (. 30, 89) 1. 32 (.38, 4.63) 1. 42 (.49, 4 .08 ) 1 .56 ( .52 , 4. 70) 1. 08 (1. 00 , 1. 17) 42 ( .17 , 1. 02 ) 1 .56 ( . 50 , 4.79) 1. 08 ... 1. 08 (.99, 1. 17) 38 (. 15 , 99) 22 (. 01 , 4.33) 4. 35 (1. 81, 10 .47) 4.38 (1. 79, 10 .72) 1. 09 (1. 00 , 1. 18) 67 (.33, 1. 33) 4.38 (1. 79, 10 .72) 1. 09 (1. 00 , 1. 19) 65 (.32, 1. 31) 1. 62 ( .12 , 21. 11) *CV = coefficient...
- 8
- 402
- 0
Báo cáo y học: "MMP-3 expression and release by rheumatoid arthritis fibroblast-like synoviocytes induced with a bacterial ligand of integrin α5β" pdf
... regulatory factor X14 454 9.4 15 . 3 3.4 Fibroblast growth factor -5 M378 25 3 .5 2.9 5. 7 CDC27Hs protein U 000 01 7.4 - 10 .6 Interferon gamma antagonist A2 52 70 5. 4 - 13 .0 Integrin αE L 258 51 3.9 - 3 .5 Vimentin ... GenBank accession no 3a IL-6 X04 602 3 .0 3.8 6.8 Interferon-gamma receptor β subunit U 05 8 75 5.8 - 7.7 Interferon regulatory factor X14 454 - 11 .0 5. 5 Leukemia inhibitory factor X13967 4 .1 - 5. 0 Matrix ... (glyceraldehyde-3-phosphate dehydrogenase), 1) 5' AGC AAT GCC TCC TGC ACC ACC AAC 3' and 2) 5' CCG GAG GGG CCA TCC ACA GTC T 3' [27] After incubation at 50 °C for 10 and at 95 C for 10 min, samples were subjected...
- 9
- 395
- 0
Báo cáo y học: "The shunt from the cyclooxygenase to lipoxygenase pathway in human osteoarthritic subchondral osteoblasts is linked with a variable expression of the 5-lipoxygenase-activating protein" doc
... MN, USA) for IL - 10 and from Medical and Biological Laboratories Co (Nagoya, Japan) for IL -18 (specificity 10 0% for both, sensitivity 0 .5 pg/ml for IL - 10 and 12 .5 pg/ml for IL -18 ) were used as described ... system's manual (Pierce, Brockville, Ontario, Canada) COX-2 levels were determined with a polyclonal rabbit anti-human COX-2 antibody (Cayman Chemical-Cedarlane, Hornby, Ontario, Canada) at a 1: 400 dilution ... an agarose gel and revealed by ultraviolet detection Densitometric analysis was performed for each amplimer against that for GAPDH with a ChemiImager 400 0 (Alpha Innotech Corporation, San Leandro,...
- 10
- 459
- 0
Báo cáo khoa học:" Treatment with lamivudine versus lamivudine and thymosin alpha-1 for e antigen-positive chronic hepatitis B patients: a meta-analysis" doc
... was supported by the National Basic Research Program of China (No. 200 7CB 512 902 and 200 6CB 504 302 ) and Development Program of China during the 11 th Five-Year Plan Period ( 200 8ZX 100 02 -00 6) We also ... 72( 35/ 37) 98(49/49) 81( 41/ 40) 60( 29/ 31) 68(33/ 35) T 1 24w+LAM 52 w T 1 52 w+LAM 52 w T 1 6m+LAM 12 m T 1 26w+LAM 52 w T 1 26w+LAM52w T 1 6m+LAM12m T 1 6m+LAM12m T 1 6m+LAM12 -18 m HBV DNA(-) HBV DNA(-) ... 0. 000 01 ) than did monotherapy Further, combination therapy may improve the rates of ALT normalization (P < 0. 000 01 ) , HBV DNA loss (P = 0. 03), and HBeAg seroconversion (P < 0. 000 01 ) at the end of 12 ...
- 9
- 269
- 0
Báo cáo khoa học: " Treatment with lamivudine versus lamivudine and thymosin alpha-1 for e antigen-positive chronic hepatitis B patients: a meta-analysis" doc
... was supported by the National Basic Research Program of China (No. 200 7CB 512 902 and 200 6CB 504 302 ) and Development Program of China during the 11 th Five-Year Plan Period ( 200 8ZX 100 02 -00 6) We also ... 72( 35/ 37) 98(49/49) 81( 41/ 40) 60( 29/ 31) 68(33/ 35) T 1 24w+LAM 52 w T 1 52 w+LAM 52 w T 1 6m+LAM 12 m T 1 26w+LAM 52 w T 1 26w+LAM52w T 1 6m+LAM12m T 1 6m+LAM12m T 1 6m+LAM12 -18 m HBV DNA(-) HBV DNA(-) ... 0. 000 01 ) than did monotherapy Further, combination therapy may improve the rates of ALT normalization (P < 0. 000 01 ) , HBV DNA loss (P = 0. 03), and HBeAg seroconversion (P < 0. 000 01 ) at the end of 12 ...
- 9
- 188
- 0
Đề tài " The distribution of integers with a divisor in a given interval " ppt
... 1+ log a1 η L (a2 ; η) r,C log a1 L (a2 ; η) η 412 KEVIN FORD Also, t 15 / 16 /h + P + (h) ≥ P + (a1 ) ≥ eθ , so T5 r,C η3 a1 ∈P(eθ ,eη ) a1 >t1 /16 log a1 a1 a2 ∈P(eη ,teη ) L (a2 ; η) a2 By Lemma ... (iii) H(x, y, z) if z ≥ y + and x ≤ 10 00 00; x if x ≥ 10 00 00, ≤ y ≤ 10 0 and √ (v) If x > 10 00 00, 10 0 ≤ y ≤ z − and y ≤ x, log(z/y) = η β max (1, −ξ)(log y)G(β) H(x, y, ... (a1 )τ (a2 ) (7.6) Also (7.7) a1 τ (a1 ) a1 >w −3/4 a1 w 1/ 4 (w ≥ 1) a1 >w ˆ The contribution to S(t; σ) coming from those a with a1 ≥ t1/8 is thus (7.8) σ a2 ∈P ∗ (eσ ,teσ ) τ (a2 ) a2 a1 ≥t1/8...
- 68
- 409
- 0
Báo cáo khoa học: Molecular design of a nylon-6 byproduct-degrading enzyme from a carboxylesterase with a b-lactamase fold ppt
... (% )b a b Hyb-24DNY -A1 12 –Ald P32 21 P32 21 96.66 11 2.94 1. 00 00 50 1 . 51 (1 .56 1 . 51 ) 96.69 11 2. 91 1 .00 00 50 1 . 51 (1 .56 1 . 51 ) 03 7 212 96 06 2 ( 9 51 5) 54 9 789 96 0 45 (9326) 99.9 ( 10 0) 99 .5 (97 .5) 5. 0 (26 .5) ... 0. 70 13 .4 2.73 5. 44 1. 78 0. 25 4. 40 0.28 < 0. 0 05 0. 28 1. 28 0 .19 0. 027 0. 0 51 0. 003 8 0. 088 (1) ( 20) (0. 35) (8.2) ( 15 3 ) (78) ( 60) (0. 04) ( 15 7 ) Table Kinetic parameters of His-tagged Hyb-24 and its ... 0. 900 0 50 1. 60 (1. 66 1. 60) 15 2 434 10 7 9 85 ( 10 619 ) 882 657 81 04 4 (7973) 99.8 (99 .0) 10 0. 0 (99.9) 8.2 (49.6) 6.3 (43 .5) 25. 5 (3 .0) 38 .5 (4 .0) 41. 9 1. 45 (1 .54 1. 45) 18 .7 (26 .0) 19 .9 (27 .5) 31. 7 1. 60...
- 10
- 625
- 0
Báo cáo Y học: Solution structure of the Alzheimer amyloid b-peptide (1–42) in an apolar microenvironment Similarity with a virus fusion domain potx
... < ¼ 0 .5 0 .5 < d ˚ Average maximum violation (A) 26.9 9.7 1. 6 0. 7 0. 43 ± ± ± ± 4 .1 2.2 1. 1 0. 4 ± 0. 03 Energy term Average AMBER energies (kcalỈmol )1) E E E E )4 15 . 7 25. 5 ) 15 9 .6 )3 90 .1 (AMBER) ... 10 0 11 1 16 Rajan, R., Awasthi, S.K., Bhattachajya, S & Balaram, P (19 97) ÔTeflon-coated peptidesÕ: hexafluoroacetone trihydrate as a structure stabilizer for peptides Biopolymers 42, 1 25 12 8 17 Atherton, ... support, loaded with Na-Fmoc-Ala (Fmoc-Ala-PAC-PEG-PS) was from Millipore (Waltham, MA, USA) Fmoc-Ala-PACPEG-PS resin (0. 15 mmolỈg )1, g) was treated with piperidine ( 20% ) in dimethylformamide and...
- 7
- 624
- 0
Báo cáo khoa học: Concerted mutation of Phe residues belonging to the b-dystroglycan ectodomain strongly inhibits the interaction with a-dystroglycan in vitro pot
... 7 50 )Phe 700 fi Ala, b- DG( 654 – 7 50 )Phe 718 fi Ala, b- DG( 654 – 7 50 )Val736 fi Ala, b- DG( 654 – 7 50 )Phe692 fi Ala ⁄ Phe 718 fi Ala, b- DG( 654 – 7 50 )Phe692 fi Ala ⁄ Phe 700 fi Ala ⁄ Phe 718 fi Ala and b- DG( 654 – 7 50 )D(7 01 ) 706 ), ... GTTAGTAGGTGAGAAATCGGCGGTTCAGTTTAACAGCAACA TGTTGCTGTTAAACTGAACCGCGCATTTCTCACCTACTAAC GAGAAATCGTGGGTTCAGGCCAACAGCAACAGCCAGCTC GAGCTGGCTGTTGCTGTTGGCCTGAACCCACGATTTCTC TCGTGGGTTCAGTTTAACAGCAACAGCCAGCTC ... Lane 1: a- DG(4 85 6 30) Trp 5 51 –Ala ⁄ Phe 554 fi Ala Lane 2: a- DG(4 85 6 30) Asn 555 fi Ala Lane 3: a- DG(4 85 6 30) Phe 554 fi Ala Lane 4: a- DG(4 85 6 30) Trp 5 51 fi Ala Lane (control): a- DG(4 85 6 30) (B) Solid-phase...
- 15
- 337
- 0
Báo cáo Y học: A polymer with a backbone of 3-deoxy-D-glycero -D-galacto -non-2ulopyranosonic acid, a teichuronic acid, and a b-glucosylated ribitol teichoic acid in the cell wall of plant pathogenic Streptomyces sp. VKM Ac-2124 pdf
... 1 75. 1 (C) 17 6 .0 97.6 40. 4 70. 35 71. 6 72.6 (D) 10 2.8 74.6 77 .0 71. 0 77 .1 61. 9 (E) 68 .0 71. 8 72 .5 80. 4 65. 8 (F) Polymer I fi6) -a- D-Glcp- (1 fi4) -b- D-ManpNAc3NAcA- (1 C -1 103 .6 74.6 77 .0 70. 9 77 .1 ... unequal intensities at d 103 .6, 10 2.8, 10 1.2, 10 0. 2, and 97.6 (Table 1) As followed from the APT spectrum (Fig 1) , four signals at d 100 .2 10 3.6 belonged to the protonated anomeric carbon atoms, ... Streshinskaya, G.M., Subbotin, S .A & Tiedje, J.M ( 20 01 ) Agreia bicolorata gen nov., sp nov to accommodate actinobacteria isolated from narrow reed grass infected by nematode Heteroanguina graminophila...
- 6
- 561
- 0
Báo cáo " Developing adaptive hypermedia system based on learning design level B with rules for adaptive learning activities " ppt
... suitable for adaptation process because Level A has only very limited support for personalization and adaptation 2 .1 Learning design level B There are a lot of elements that level B adds to level A: ... three levels A, B and C [ 10 ] These levels allow modeling UOL, focused on collaboration, adaptation, adaptability or any other pedagogical method Every level adds to the previous one a number of ... satisfy Satisfy Protest Structure ( 20% ) 32 ( 80% ) 0% Interface 10 ( 25% ) 28 ( 70% ) (5% ) Adaptation 12 ( 35% ) 26 ( 60% ) (5% ) Meet 15 (38%) 21 (52 %) ( 10 %) demand Conclusions and future work C se hoo le arninggo...
- 12
- 508
- 0
Báo cáo khoa học: NMR solution structure of Cn12, a novel peptide from the Mexican scorpion Centruroides noxius with a typical b-toxin sequence but with a-like physiological activity doc
... constraints 36 (u) ˚ (C) Cartesian coordinate rmsd (A) in backbone atoms All 1. 994 Backbone All 1. 09 7 Residues 11 52 0. 968 Helix(24–32) 0. 259 b- strand(2–4) 0. 4 21 b- strand(37– 40) 0. 2 61 b- strand( 45 48) ... b- strand( 45 48) 0 .17 3 b- sheet 0 .53 2 b- strand and helix 0. 612 (D) Energy (kcalỈmol )1) calculated from CNS (19 structures) Total 97.9 (+ 15 . 6) Bonds 5. 0 ( +1. 1) Angles 28.7 (+4.3) van der Waals 35. 8 ( +5. 5) NOE ... higher affinity than to rat brain synaptosomes [ 51 ]) In addition, some toxins are capable of discriminating between Na+-channel isoforms of the same organism (e.g the rat brain isoform rNaV1 .1 is 10 -fold...
- 13
- 434
- 0
Báo cáo sinh học: " Unusual presentation of hepatitis B serological markers in an Amerindian community of Venezuela with a majority of occult cases" doc
... 98 A 10 0 G 10 0 Figure C 94 B AY0 90 459 AF223963 10 0 AB0643 15 H AY0 90 457 E X 756 64 10 0 AB0 91 256 87 AB03 355 9 AB03 355 8 419 4BAMAZ 10 0 90 AB064 314 X 519 70 AF16 05 0 1 AB0268 15 0. 05 V 008 67 D 003 30 FI A B AY 311 370F ... 75JAPREIRA 80JAPREIRA 3 01 9 AMAZP BP164-2 BP134 BP74,BP97 BP136 AY 311 3 70 BP147,BP 15 0 BP 15 6 BP 15 4 AB036 916 AB0369 20 BP88 BP92 BP1 31- 1 84 11 4AMAZY BP132 -1 BP29 BP 21_ DEL BP 21 100 F FIV FII FIII AB086397 ... AY 311 370F BP 213 BP 211 BP29 BP88 BP134 BP 15 6 BP BP BP 13 1 211 212 Figure BP 213 AY 311 370F BP 213 BP 211 BP 212 BP29 BP74 BP88 BP92 BP134 BP136 BP147 BP 15 4 BP 15 6 19 MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM...
- 13
- 375
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25