... Thúc đảy CNTB phát triển Quan hệ SXPK >< Tư s n Thuộc địa >< nông nô Phương Đông Ra đời muộn, s m tan rã...
Ngày tải lên: 11/10/2013, 07:11
... cells, respectively After insulin treatment, PKB activity was almost doubled in the mock and S- PKB/ H7721 cells, but it increased not so obviously in AS-PKB/ H7721 cells (Fig 7C) These results ... + Ins, AS-PKB, AS-PKB + Ins, as in Fig S- PKB, Sense-PKB cDNA transfected H7721 cells; S- PKB + Ins, S- PKB/H7721 cells treated with nM insulin The incubation time for all the cell groups was 48 ... after 2–3 weeks and re-cloned by serial dilution The stable cells transfected with sense and antisense PKB were named S- PKB/H7721 and AS-PKB/H7721 Cell culture and treatment Cells were cultured for...
Ngày tải lên: 21/02/2014, 00:20
Báo cáo Y học: The plant S-adenosyl-L-methionine:Mg-protoporphyrin IX methyltransferase is located in both envelope and thylakoid chloroplast membranes pot
... Scienti®que des Dombes, Chatillon-sur-Chalaronne, France) Western à blot analyses were performed using Arabidopsis, spinach or transformed E coli subcellular fractions, as described previously [23] ... the envelope and in the thylakoids play differential roles regarding chlorophyll biosynthesis and production of plastidic signals responsible for controlling nuclear gene expression The sorting ... also present in the thylakoids but presumably involved in heme synthesis [4] and POR can associate with the thylakoids [9] Finally, the ®nal steps of chlorophyll synthesis, such as addition and reduction...
Ngày tải lên: 08/03/2014, 16:20
Báo cáo sinh học: "Multiplex Zymography Captures Stage-specific Activity Profiles of Cathepsins K, L, and S in Human Breast, Lung, and Cervical Cancer" potx
... variability, as seen in the box-whisker plot, and, as a result, comparisons of all normal samples to all tumor samples was not statistically significant However, there were significant differences ... may serve as a supplemental biomarker to aid the assessment of inconclusive Pap smear results Again, more clinical samples will need to be tested to verify its utility, but cathepsin K also presented ... at inflammatory situations are theoretically possible and need to be further tested with clinical samples Fluorescent activity based probes (ABP) in tissue sections provide incredible resolution...
Ngày tải lên: 18/06/2014, 22:20
Báo cáo toán học: " Inequalities for convex and s-convex functions on Delta=[a,b]x[c,d]" potx
... b, c+ d dt ds b a b a d−c d−c ∂f s = (b − a) + a +b t−a d s s−c b t a+ b, c+ d dt ds b a b a d−c d−c d = (b − a) b t t−a d s s−c a+ b, c+ d b a b a d−c d−c b t t−a d s s−c a+ b, c+ d dt b a b a ... d−c b t t−a d s s−c a+ b, c+ d dt ds b a b a d−c d−c SOME INTEGRAL INEQUALITIES d = ∂f (t − a) s q (y, s) c a +b − a ∂f s b − a +b ∂f s b t t−a d s s−c a+ b, c+ d b a b a d−c d−c ∂f s q (y, s) ... [19], Pachpatte established a new Ostrowski type inequality similar to inequality (1.5) by using elementary analysis The main purpose of this article is to establish inequalities of Hadamard-type...
Ngày tải lên: 20/06/2014, 21:20
Anh văn lớp 7 - Unit five: Work and play. B/ It’s time for recess. (B1,2) docx
... games are they playing? (can speak by Vietnamese) Listen and read these words Introduce the new words: Blindman s bluff, Skip rope, Chat, Marbles, Catch Play the tape, and ask students to look Listen ... students are playing Talk about yourselves these games, and you? Now you talk about yourselves Work with a partner The first teacher makes questions and students answer them Then students ask each ... (Can ask students to read these and give it in frond of the class 4, Production words.) *Mai is playing catch Kien is playing blindman s bluff Play this game Lan is skipping rope Ba is playing...
Ngày tải lên: 03/07/2014, 16:21
Anh văn lớp 7 - Unit five: Work and play. B/ It’s time for resess. (B3+ B4 + B5) pptx
... partner USA 3, Practice Basketball Vietnam Talk about activities of students in Play games USA and in Vietnam usually play at Listen to music ( marble, catch recess Swap cards ( need talk full sentences) ... for students Listen to the tape Have students listen to it and read silently while listening Go around the class and help Read silently and can write these students by giving some new words words: ... pairs Work in pairs about the part Questions Listen to students’ keys and give Give answers correct answers: a C c D b A d D Ask students to read full answers Read full answers Have students work...
Ngày tải lên: 03/07/2014, 16:21
Creating drought tolerance lines and isolating cystatin genes related to drought tolerance in peanut (Arachis hypogaea L.)
... the results analysis of the characteristics of agricultural biology seed quality resistant and molecular biology characteristics of selective line derived from callusis blow dry and callusis irradiated ... 4,97 Small, yellow and fallen leaves, curly leaves edges 4,0krad 12,51 ± 0,42 21,30 ± 6,03 Small, yellow and fallen leaves, curly leaves edges Radiation dose combination blower hours Patterns of ... tolerance of plants has been isolated and published such as LEA genes in soybean and green beans, P5CS gene in soybean, cystatin genes in green bean plants, DREB genes in Arabidopsis, etc Cystatin...
Ngày tải lên: 24/06/2015, 00:56
CREATING DROUGHT TOLERANCE LINES AND ISOLATING CYSTATIN GENES RELATED TO DROUGHT TOLERANCE IN PEANUT (Arachis hypogaea L.)
... tolerance are studied by many scientists Several genes related to drought tolerance of plants has been isolated and published such as LEA genes in soybean and green beans, P5CS gene in soybean, ... quality resistant and molecular biology characteristics of selective line derived from callusis blow dry and callusis irradiated combined with blow dry breeds L1 8 is presented in ficture 3.11 and ... TECHNICAL CALLUS TREATMENT IN THE IN VITRO CULTURED SYSTEM 3.1.1 Screening lines callus subjject blow dry 3.1.1.1 Ability to create scar tissue and the growth of scar tissue studied 10 breeds optimism...
Ngày tải lên: 20/04/2016, 10:05
Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"
... distributions of 148 the genotypes or alleles between EH patients and NT subjects were tested using a two-sided Fisher s exact test Multiple logistic regression analyses were done to assess the ... analysis in EH females, as none of them had the 16 repeat allele All subjects were classified into groups based on their BMI levels (lean, BMI
Ngày tải lên: 26/10/2012, 10:04
Contributions of Various Noncovalent Bonds to the Interaction between an Amide and S-Containing Molecules
... interaction is rather unusual, and one that is not commonly observed Its absence from Perhaps emblematic of this entire problem, the global minithe literature is understandable as it occurs only in tandem ... antibond As is true for most NBO virtual orbitals, the p* CO is partially occupied Nonetheless, its willingness to part with a portion of its small occupation to the benefit of the SS s* orbital ... Figure S2 ) are also stabiantibonding orbital The O atom serves as proton acceptor for lized by CHãããO H-bonds, followed by a weaker complex, with two methyl CH groups, both less than 2.5 in length...
Ngày tải lên: 16/12/2012, 15:21
Thực trạng và giải pháp phát triển hệ thống cửa hàng tiện lợi Citimart B and B
... thống [Thị trường b n l Việt Nam: Đa dạng tiềm năng] http://vnbusiness.vn/articles/th%E1%BB% 8B- tr%C6 %B0 %E1%BB%9Dng -b% C3%A1n -l% E1%BA%BBvi%E1%BB%87t-nam-%C4%91-d%E1%BA%A1ng-ti%E1%BB%81m-n%C4%83ng/ ... Hình 2.5: S đồ b trí quầy hàng cửa hàng Citimart B& B Nam Long 2.3 Phân tích SWOT Dựa phân tích b n trên, nhóm nghiên cứu xin trình b y b ng phân tích SWOT cửa hàng Strengths - Weaknesses Hệ thống ... quận Hình 2.1: S đồ b trí quầy hàng cửa hàng Citimart Sommerset b Đối vớichi nhánh Citimart B& B, NguyễnLương B ng, quận Tầngtrệt Hình 2.2: S đồ b trí quầy hàng cửa hàng Citimart B& B Green View...
Ngày tải lên: 01/04/2013, 11:40
unit 6: after school/B: let''s go!
... her house and listen to music d) Why doesn’t Hoa want to go to lan s house? Because she has too many assignments e) What day s it? It is Saturday Exercise: ViÕt mét ®o¹n héi tho¹i ®ã s dông ... have too many assignment Nam: hoa! It s Sunday tomorrow Why don’t you relax? Ba: come on Let s go to lan s house Lan: are you going to come, hoa? It’ll be fun Hoa: OK I’ll come Thanks Nam: great! ... Read: Ba: what should we this evening? Nam: what about going to the movie? Lan: there aren’t any good movie on at the moment Let s go to my house We can listen to some music Hoa: I’m sorry, lan...
Ngày tải lên: 07/06/2013, 01:26
B and V Minimal Pair Quiz .doc
... vanished b banished As well as employing a butler, Lord Harley had a personal _ to help him dress a valet b ballet Above the curtains the cloth or wood box border is called a _ a valance b balance ... a rebel b revel 14 First time sailors are derisively known as "land _" by seasoned veterans a lovers b lubbers 15 _ or original ideas are welcome in literature and science a Novel b Nobel 16 ... its axis to find South America a glove b globe 18 Let 's all support Women 's _! a Live b Lib 19 She never misses a chance to make a _ about her husband 's eating habits a jibe b jive http://binhqx.violet.vn...
Ngày tải lên: 25/08/2013, 08:10
Tài liệu B GIÁO D C & ÀO T O I H C HU KHOA Y T CÔNG C NG B môn: S c kh e môi trư ng -----&*&----- BÀI docx
... J .L , Patz J A , (2001), Ecosystem Change and Globan Health : A Global Perpective, Baltimore , Md , Johns Hopkins University Press Bassett W.H., (1995), Clay 's handbook of Environmental Health, ... Central cencus Steering Committee Thegioi Publishers 12 Xiang Biao (2003), Migration and health in China: Problems, Obstacles and Solutions, (http://www.populationasia.org Cõu h i l ng giỏ cu i bi ... d ng CO2 Ch t r n l l ng (SS) ho c t ng s ch t r n l l ng (TSS: total suspended solid) l m t ph n c a ch t r n cú n c d ng khụng hũa tan Hm l ng TSS n c s cho bi t hm l ng s t, mựn v nh ng ph...
Ngày tải lên: 22/12/2013, 23:16
Tài liệu PREVENTION AND TREATMENT OF CANCER-RELATED INFECTIONS docx
... for candidemia and invasive candidiasis, but significantly less toxic · 45% success rate as salvage therapy for invasive aspergillosis · Similar efficacy, but less toxic compared with L- AMB as empirical ... quinupristin/dalfopristin has been limited because of the high frequency of substantial musculoskeletal symptoms.96 Initial Empiric Therapy for Patients Who Are Clinically Unstable Sepsis is suggested ... bone and joints, veins and heart, meninges, soft tissues with necrosis, or skin/soft tissue/wound/cellulitis greater than cm Simple bacteremias are associated with less tissue involvement (bacteruria,...
Ngày tải lên: 14/02/2014, 22:20
Tài liệu Báo cáo khoa học: parDtoxin–antitoxin system of plasmid R1 – basic contributions, biotechnological applications and relationships with closely-related toxin–antitoxin systems ppt
... also highlight the structural and functional relationships between parD and closely -related TA systems with a special reference to ccd of plasmid F, whose toxin, CcdB, shares a substantial structural ... wild-type system went unnoticed but, once discovered, its stabilization could be detected in different related assays: (a) a R1-miniplasmid carrying a deletion of the system was slightly less stable ... system of plasmid F, as well as that of the parDE TA system of plasmid RK2 ⁄ RP4 and hok-sok of plasmid R1 In this analysis, a resident mini-R1 plasmid carrying one of these systems was displaced...
Ngày tải lên: 18/02/2014, 04:20
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc
... reducing SDS ⁄ PAGE buffer, and this was followed by SDS ⁄ PAGE and Coomassie Brilliant Blue staining or western blot analysis Cell-free translocation of mitochondria-associated cytochrome c A rat liver ... FVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGA LLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWP LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 Fig Structural characteristics of ETA fragments generated by cathepsin ... GWEQLEQCGYPVQRLVALYLAARLSWNQVDQV IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCP VAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYV FVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGA...
Ngày tải lên: 18/02/2014, 04:20
Tài liệu Báo cáo khoa học: The Pseudomonas aeruginosa nirE gene encodes the S-adenosyl-L-methionine-dependent uroporphyrinogen III methyltransferase required for heme d1 biosynthesis doc
... methyltransferase which is specifically required for heme d1 biosynthesis Materials and methods Chemicals Unless stated otherwise, all chemicals, reagents and antibiotics were obtained from Sigma-Aldrich ... aeruginosa also possesses the genes encoding the SUMTs involved in cobalamin (cobA) and siroheme (cysG) biosynthesis, the nirE gene product was found to be essential for heme d1 biosynthesis A P ... from the soluble protein fraction using C18-reversed phase material and analysed by UV-visible absorption spectroscopy and mass spectrometry In both cases (NirE-His and Trx -S- NirE-His production)...
Ngày tải lên: 18/02/2014, 06:20