antibody amp 8211 antigen interactions and stabilization of polyaniline electrodes with p sulfonated poly bisphenoxyphosphazene
![Báo cáo khoa học: Benzo[a]pyrene impairs b-adrenergic stimulation of adipose tissue lipolysis and causes weight gain in mice A novel molecular mechanism of toxicity for a common food pollutant doc](https://media.store123doc.com/images/document/14/rc/rp/small_luUKRIz7Xm.jpg)
Báo cáo khoa học: Benzo[a]pyrene impairs b-adrenergic stimulation of adipose tissue lipolysis and causes weight gain in mice A novel molecular mechanism of toxicity for a common food pollutant doc
... most apolar region of the phospholipid matrix, resulting in an expanded and swollen membrane [32] We, therefore, propose that distortion of the physiochemical properties of the adipocyte plasma ... concentrations of a common food pollutant, B[a ]P, caused a rapid, direct and profound inhibition of adipose tissue lipolysis stimulated by epinephrine, dobutamine, salbutamol, BRL37344 and ACTH This ... indicate that inhibition of lipolysis by B[a ]P proceeds via direct inhibition of the early step of b-adrenergic receptor and ACTH receptor signalling to their respective G-coupled proteins Indeed, the...
- 11
- 424
- 0
BIOTECHNOLOGY MOLECULAR STUDIES AND NOVEL APPLICATIONS FOR IMPROVED QUALITY OF HUMAN LIFE potx
... “Antihypertensive Peptides Specific to Lactobacillus Helveticus Fermented Milk” mainly reviews processing of antihypertensive peptides, Val-Pro-Pro (VPP) and Ile-Pro-Pro (IPP), by proteolytic enzymes of L ... thermotolerans, and Pseudoalteromonas sp, are capable of producing biofilms and produce chemical compounds that protect them from the other protozoans An example of these compounds is violacein, ... Indonesia, Peru, Canada, Scandinavia, Ireland, Wales, the Philippines and Scotland, among other places From the economic point of view the marine algae represent an important resource of food and industrial...
- 250
- 458
- 0
Báo cáo y học: " Ancient, independent evolution and distinct molecular features of the novel human T-lymphotropic virus type 4" pot
... HTLV-3(ORFIV) HTLV-2 (p2 8XII) HTLV-4(ORFV) MDHLGPHRWTSCRLASPIPYPSPPLLPHPTNLQDPQSPYPTNHSCHPQGSTLLLSVRAEA SRPTGHLSRAS .RY S.TV T EM. -ACPSRHLPGAPA R S .A E G.HSPY L D R.FPIH.-PCPTGHVPRTS.Y .R.Q.S.T ... HTLV-3(ORFIV) HTLV-2 (p2 8XII) HTLV-4(ORFV) QPLPQRMS -H KW.PGTNPRGSAPLPRLPRTWPPSPKHLHHLGKNRSMPIPIPAFPTHDMATYTPCHILPPQTIRSL -M.V.S L.PHS Q AAWRF 68 87 113 118 147 25 HTLV-4(ORFIV) ... HTLV-2(Efe) STLV-2(PP1664) HTLV-1(ATK) HTLV-3(2026ND) STLV-3(TGE2117) VPPSFFQSVRRHSPYRNGCLETTLGEQLPSLAFPEPGLRPQNVYTIWGKTIVCLYIYQLSPPMTWPLIPHVIFCNPRQLGAFLSNVPPKRLEELLYKLYL A M.K.T P D I T V L H...
- 20
- 320
- 0
Báo cáo y học: " Potential applications of curcumin and its novel synthetic analogs and nanotechnology-based formulations in cancer prevention and therapy" pps
... factor-kappa B; PARP: poly( ADP-ribose) polymerase; PI3K: phosphatidylinositol-3’-kinase; PTCH: patched receptor; PTEN: phosphatase tensin homolog deleted on chromosome 10; RTK: receptor tyrosine ... Curcumin suppresses human papillomavirus oncoproteins, restores p5 3, Rb, and PTPN13 proteins and inhibits benzo[a]pyrene-induced upregulation of HPV E7 Mol Carcinog 2011, 50:47-57 Yallapu MM, Gupta ... Curcumin-induced antiproliferative and proapoptotic effects in melanoma cells are associated with suppression of IkappaB kinase and nuclear factor kappaB activity and are independent of the B-Raf/mitogen-activated/...
- 19
- 434
- 0
Tài liệu Plug and Play Splitter Architectures Drive Operational Savings doc
... two splitter configurations available – pigtail -and- play or plug -and- play Although both offer substantial benefits over straight splicing, the plug -and- play has additional advantages For example, ... But with a plug -and- play splitter design, the connection is made between the F1 and the splitter simply by plugging the splitter in the backplane of the cabinet Page One argument for the pigtail -and- play ... Plug and Play Splitter Architectures Drive Operational Savings After service providers decide to deploy a particular fiber-to-the-premise (FTTP) architecture, they are faced with a number of...
- 4
- 238
- 0
Tài liệu TRADITIONAL AND NOVEL RISK FACTORS IN ATHEROTHROMBOSIS pptx
... stratification and prediction of prognosis, particularly in troponin negative patients 3.3 Pregnancy-Associated Plasma Protein A (PAPP-A) PAPP-A is a matrix metalloproteinase (MMP), one of a family of at ... of the performance of H-FABP, if we were to apply the test in a typical United Kingdom ED population with suspected cardiac chest pain who have a prevalence of AMI of approximately 18%, the post-test ... months, albeit with a sensitivity of only 54%, specificity 75%, PPV 30% and NPV 15% (180) In a study of 364 ED patients with suspected ACS, Laterza et al reported that PAPP-A predicted adverse...
- 150
- 453
- 0
Traditional and Novel Risk Factors in Atherothrombosis Edited by Efraín Gaxiola pot
... stratification and prediction of prognosis, particularly in troponin negative patients 3.3 Pregnancy-Associated Plasma Protein A (PAPP-A) PAPP-A is a matrix metalloproteinase (MMP), one of a family of at ... of the performance of H-FABP, if we were to apply the test in a typical United Kingdom ED population with suspected cardiac chest pain who have a prevalence of AMI of approximately 18%, the post-test ... months, albeit with a sensitivity of only 54%, specificity 75%, PPV 30% and NPV 15% (180) In a study of 364 ED patients with suspected ACS, Laterza et al reported that PAPP-A predicted adverse...
- 152
- 401
- 0
Coronary Artery Disease – New Insights and Novel Approaches Edited by Angelo Squeri pdf
... Apopliporptein B-100; Sitosterolemia; Type III Hyperlipoproteinemia, Homocystinuria, Familial HDL deficiencies (apolipoprotein A1), Familial Combined Hyperlipidemia Apopliporptein B-100; Lipoprotein ... rate-controlling step in the removal of cellular Chol, i.e the efflux of cellular Chol and phospholipids to an apolipoprotein acceptor Apo A is composed of repeated loop-shaped units called kringles, ... surface and readily released by heparin It is homologous to LPL and pancreatic lipase and hydrolyzes TGs and phospholipids in all lipoproteins, but is predominant in the conversion of IDL to LDL and...
- 270
- 931
- 0
Báo cáo Y học: Modulation of the oligomeric structures of HIV-1 retroviral enzymes by synthetic peptides and small molecules pptx
... using a surface representation HIV-1 PROTEASE Structure and function of HIV-1 PR HIV-1 PR catalyzes the hydrolysis of specific peptide bonds within the HIV-1 Gag and Gag-Pol polyproteins to generate ... LacZ(negative)-Tet(sensitive) phenotype [27] Co-transformation of the reporter plasmid with a peptide plasmid library allows for the selection of peptides that prevent NcI-PR dimerization and generate transformants ... dimeric PR Cross-linked interfacial peptides ˚ containing a tether region of approximately 10 A inhibit PR dimerization by permitting the formation of a pseudo antiparallel b sheet with one of the PR...
- 9
- 494
- 0
Báo cáo khoa học: "Formal aspects and parsing issues of dependency theory Vincenzo Lombardo and Leonardo Lesmo" potx
... Aspects Of Lexicalized Grammars, Ph.D Dissertation MS-CIS-90-48, Dept of Computer and Information Science, University of Pennsylvania, Philadelphia (PA), August 1990 SgaU P. , Haijcova E., Panevova ... sets of u-triples (including empty sets, when applicable) provided by the various items are stacked in order to verify the consumption of one u-triple in the appropriate subtree (cf the notion of ... The paper has described a dependency formalism and an Earley-type parser with a polynomial complexity The introduction of non lexical categories in a dependency formalism allows the treatment of...
- 7
- 327
- 0
Báo cáo khoa học: Investigation of leucine-rich repeat kinase 2 Enzymological properties and novel assays pptx
... implicated in PD, and understanding its properties and functions will aid in our understanding of disease pathology and progression Experimental procedures Chemicals and reagents All compounds and proteins ... lead to PD with pleiomorphic pathology and symptoms For example, patients with mutations in the GTPase domains have been shown to have different combinations of tauopathies and synucleinopathies, ... of ATP for LRRK2 Proteins were incubated with 400 lm LRRKtide in the presence of varying concentrations of ATP, and the incorporation of 3 2P into LRRKtide was assessed The apparent Km for ATP...
- 13
- 292
- 0
Báo cáo khoa học: Huntington’s disease: roles of huntingtin-interacting protein 1 (HIP-1) and its molecular partner HIPPI in the regulation of apoptosis and transcription pptx
... interact with HIPPI and increase HIPPI-mediated apoptosis through the caspase-8-mediated pathway Rybp also interacts with ubiquitin-binding protein, procaspase-8, procaspase-10, and the HIPPI interactor ... al HIPPI HIP1 Freely available HIP1 Strong interaction Weak interaction Nucleus pDED of HIPPI N-terminal of HIPPI Mutant Htt Caspase-8 ? Normal Htt ? Pro-caspase Caspase1 Caspase Apoptosis Pro-caspase ... activation of caspase-8, caspase-1, caspase-9 ⁄ HIP-1 & HIPPI mediated apoptosis and transcription caspase-6, and caspase-3 Cleavage of Bid and release of cytochrome c and apoptosis-inducing factors...
- 9
- 492
- 0
Goethe and the Molecular Aesthetic ppt
... Philosophy, Arber steps back from the specifics of plant morphology and takes a more philosophical view She is trying to justify her approach, which is holistic and looks at the relationships among parts, ... In 1946 she published a translation of his Attempt to Interpret the Metamorphosis of Plants In Natural Philosophy, The Mind and the Eye, and many of her other writings, the influence of Goethe is ... because of its clear prose and its precociousness Written in the 1950s, when the philosophy of science was still dominated by physicists’ views of what science is and by a positivistic approach,...
- 17
- 212
- 0
Erectile Dysfunction – Disease-Associated Mechanisms and Novel Insights into Therapy Edited by Kenia Pedrosa Nunes potx
... messengers, cGMP and cAMP activate protein kinase (PKG and PKA respectively), which in turn phosphorylate certain proteins and ion channels, resulting in opening of the potassium channels and hyperpolarization, ... synthase; GTP, guanosine triphosphate; GMP, guanosine monophosphate; cGMP, cyclic GMP; PDE5, phosphodiesterase type 5; PKG, protein kinase G; PKA, protein kinase A 3.2 Flaccidity and detumescense ... as prostaglandin E1 (PGE1) can bind to G protein coupled receptors and activate the enzyme adenylate cyclase, which catalyzes the conversion of adenosine monophosphate (AMP) to cyclic AMP (cAMP)...
- 226
- 467
- 0
NUTRITIONAL ASPECTS and CLINICAL MANAGEMENT of CHRONIC DISORDERS and DISEASES doc
... intervention, and provides specifics on appropriate counseling and management The first of the 13 chapters discusses nutritional support for children, with emphasis on premature infants, cystic fibrosis, and ... feeding, appropriately emphasizing the importance of milk or modified milks for the nutrition of children In cystic fibrosis, the principal nutritional defect is fat malabsorption, and the use of supplementary ... requirements of patients with psychiatric disorders They deal with feeding disorders of infants and young children, pointing out that most problems can be prevented by routine support and education...
- 353
- 439
- 0
Báo cáo khoa học: Mechanistic aspects and redox properties of hyperthermophilic L-proline dehydrogenase from Pyrococcus furiosus related to dimethylglycine dehydrogenase⁄oxidase potx
... article represents the first detailed report of the kinetic and spectroscopic properties of this novel type of PRODH Results Analysis of a and b subunit sequences Sequence analysis of both subunits ... of Bradford [35] Anaerobic expression and partial purification of wild-type PRODH Anaerobic 2xYT media containing 20 mm sodium fumarate was supplemented with ampicillin (50 lgÆmL)1) and chloramphenicol ... The m ⁄ z peak at 825 represents the K+ adduct of released FAD cofactor The m ⁄ z peaks of 348 and 458 represent the [M + H]+ ion of both AMP and FMN, respectively, which result from partial hydrolysis...
- 18
- 290
- 0
Báo cáo khoa học: Structural aspects and biological properties of the cathelicidin PMAP-36 pot
... Structure and antimicrobial activity of PMAP-36 Fig CD spectra of the synthetic PMAP36 peptides Spectra of PMAP-36(1–35)2 (A) and of the truncated fragment PMAP-36(1– 20) (B) were recorded in mM phosphate ... Germany) Peptide synthesis and characterization Solid-phase peptide syntheses of PMAP-36(1–34) and PMAP-36(1–35) were performed on PE Biosystems Pioneer peptide synthesizer, thermostated at 50 °C, and ... permeabilization by the PMAP-36 peptides The outer (A, D) and the inner (B, E) membrane of E coli ML35(pYC) and of the cytoplasmic membrane of S aureus 710A (C, F) by PMAP-36(1–34) (A, B, C) and PMAP-36(1–35)2...
- 9
- 380
- 0
Imaging of the Breast – Technical Aspects and Clinical Implication Edited by Laszlo Tabar pptx
... copy and build upon published articles even for commercial purposes, as long as the author and publisher are properly credited, which ensures maximum dissemination and a wider impact of our publications ... 32-channel) with two loops in which the breasts are placed while the patient is lying in prone position The breasts should be placed as deep as possible in the coil loops, with the nipples pointing ... intensity of T2-weighted images and the presence of cysts improved the diagnostic accuracy, with a sensitivity of 91% and a specificity of 65% (Baltzer et al., 2011) Fig Example of the added value of...
- 234
- 428
- 0
Báo cáo khoa học: Glycation and glycoxidation of low-density lipoproteins by glucose and low-molecular mass aldehydes Formation of modified and oxidized particles pot
... structure of the compound and its concentration Of the two aldehydes examined, modification of Trp and Lys was more rapid with GA than with MG and the loss of Lys appears to occur earlier than that of ... of lipids and protein side chains in LDL and the depletion of a-tocopherol by glucose and the two aldehydes examined appears to proceed slowly, even in the presence of low concentrations of Cu2+ ... nontreated samples at the zero time point By 15 days, the most rapid lipid peroxidation occurred in those samples containing mM GA supplemented with lM copper ions In this case, TOH (Fig 1A) and CA...
- 11
- 401
- 0
Báo cáo khoa học: "ON REPRESENTING GOVERNED PREPOSITIONS AND HANDLING "INCORRECT" AND NOVEL PREPOSITIONS" ppt
... relationship between the non-standard and the expected prepositions: are they sisters, privatives, or is the non-standard preposition a parent of the expected preposition In the following section we present ... these examples of the use of non-standard prepositions to mark arguments (1) represent the kind of principled variation that underlies language change, and (2) support a semantic analysis of government ... determined one A small percentage of the non-standard use of prepositions appears to be random 1.3 COMPUTATIONAL APPLICATIONS OF THIS WORK In a theoretical linguistics f o r u m (Blejcr and Flank 1988),...
- 8
- 281
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008