1 17 antibodies attenuates neuronal nitric oxide synthase up regulation edema formation and cell injury following focal trauma to the rat spinal cord pdf
Báo cáo khoa học: Space, time and nitric oxide – neuronal nitric oxide synthase generates signal pulses pptx
... endotheliumderived relaxing factor and the chemical reactivity of nitric oxide J Exp Med 16 9, 10 11 10 20 Abu-Soud HM & Stuehr DJ (19 93) Electron transfer in the nitric- oxide synthases Nitric oxide ... 283, 11 734 11 742 35 Crane BR et al (19 98) Structure of nitric oxide synthase oxygenase dimer with pterin and substrate Science 279, 212 1– 212 6 36 Ghosh DK & Salerno JC (2003) Nitric oxide synthases: ... free nitric oxide Nitric Oxide 1, 18 –30 Salerno JC (2008) Neuronal nitric oxide synthase: prototype for pulsed enzymology FEBS Lett 582, 13 95 13 99 Abu-Soud HM, Wang J, Rousseau DL, Fukuto JM,...
- 12
- 402
- 0
Báo cáo khoa học: Cupiennin 1a, an antimicrobial peptide from the venom of the neotropical wandering spider Cupiennius salei, also inhibits the formation of nitric oxide by neuronal nitric oxide synthase pptx
... al range 2–8 kDa These include: (a) the neurotoxins CSTX -1, CSTX-9 and CSTX -13 [3,4]; and (b) the antimicrobial and cytolytic cupiennins 1a to 1d [5–8] The sequence of cupiennin 1a is GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2 ... 2007 FEBS 17 79 Cupiennin 1a from Cupiennius salei T Pukala et al Fig 15 N HSQC spectra of CaM in the absence of cupiennin 1a (red), and with the addition of cupiennin 1a in a : molar ratio (purple) ... and activity Nat Prod Rep 23, 368–393 12 Fersht A (19 85) Cooperative ligand binding and allosteric interactions in enzyme structure and mechanism Cupiennin 1a from Cupiennius salei 13 14 15 16 ...
- 7
- 366
- 0
Báo cáo khoa học: Thermodynamic and kinetic analysis of the isolated FAD domain of rat neuronal nitric oxide synthase altered in the region of the FAD shielding residue Phe1395 docx
... kobs1 (s )1) WT F1395W F1395S F1395A kobs2 (s )1) kobs3 (s )1) klim1 (s )1) KNADH (mM) klim2 (s )1) KNADH (mM) 496 500 12 5 680 95 89 10 55 0.0 31 ± 0.002 0.032 ± 0.002 N/A N/A 82.6 70.3 11 4.0 13 9.6 ... (lM) kcat (s ) WT F1395W F1395A F1395S 28.2 15 .4 83.5 22.9 16 1.6 11 3.5 209.8 50.8 ± ± ± ± 4.5 11 .9 4.2 ± ± ± ± 7.2 10 .1 6.6 2.4 Km (lM) 5.7 7.4 2.5 2.2 5890 3550 3250 18 30 the FAD-stacking phenylalanine ... domain of rat nNOS (F1395W, F1395S and F1395A) and by probing the thermodynamic and kinetic consequences of these mutations We have studied the thermodynamic and kinetic properties of the isolated...
- 13
- 364
- 0
Báo cáo Y học: Amphibian peptides that inhibit neuronal nitric oxide synthase The isolation of lesueurin from the skin secretion of the Australian Stony Creek Frog Litoria lesueuri docx
... lesueurin as the original nNOS inhibitor found, citropin 1. 1, another member of inhibitor group 1, frenatin (inhibitor group 2) and caerin 1. 9 (inhibitor group 3) The fact that the regression ... lesueurin, citropin 1. 1, frenatin and caerin 1. 9, and probably the other active amphibian peptides of inhibitor groups 1 3, must therefore inhibit the formation of nitric oxide by either blocking one ... resembles cytochrome P-450 reductase Nature 3 51, 714 ± 718 38 Marletta, M.A (19 93) Nitric oxide synthase and mechanism J Biol Chem 268, 12 2 31 12 234 39 Marletta, M.A (19 94) Nitric oxide synthase: ...
- 10
- 463
- 0
Báo cáo y học: " Protein kinase A-dependent Neuronal Nitric Oxide Synthase Activation Mediates the Enhancement of Baroreflex Response by Adrenomedullin in the Nucleus Tractus Solitarii of Rats" pps
... pheochromocytoma Biochem Biophys Res Commun 19 93, 19 2:553-560 Yen et al Journal of Biomedical Science 2 011 , 18 :32 http://www.jbiomedsci.com/content /18 /1/ 32 10 11 12 13 14 15 16 17 18 19 20 21 22 23 ... hypertensive rats J Hypertens 19 98, 16 :19 93 -19 99 27 Lin LH, Taktakishvili O, Talman WT: Identification and localization of cell types that express endothelial and neuronal nitric oxide synthase in the ... Australia) To provide satisfactory anesthetic maintainance [17 ], rats received continuous infusion of pentobarbital at a rate of 15 -20 mg/kg/h throughout the recording session Microinjection The rat...
- 9
- 633
- 0
Báo cáo khoa học: "Immunohistochemical study of constitutive neuronal and inducible nitric oxide synthase in the central nervous system of goat with natural listeriosis" potx
... D and Schwartz, J.P Synthesis of nitric oxide in CNS glial cells T.I.N.S 19 93, 16 , 323-328 13 Nathan, C and Xie, Q.-W Nitric oxide synthases: Roles, tolls and controls Cell 19 94, 78, 915 - 918 14 ... encephalomyelitis J Vet Sci., 2000, 1, 11 -17 11 Moncada, S., Palmer, R.M.J and Higgs, E.A Nitric oxide: physiology, pathophysiology, and pharmacology Pharmacol Rev., 19 91, 43, 10 9 -13 4 12 Murphy, S., Simmons, ... H.D and Hauschildt, S Nitric oxide synthase: expression of the endothelial, Ca2+/calmodulin-dependent isoform in human B and T lymphocytes Eur J Immunol 19 96, 26, 511 - 516 17 Rouquette, C and...
- 4
- 437
- 0
Báo cáo y học: "Signalling pathway involved in nitric oxide synthase type II activation in chondrocytes: synergistic effect of leptin with interleukin-1" pdf
... µmol/l) and LY294002 (1, 2.5, and 10 µmol/l) for PI3K; PD098059 (1, 5, 10 , 20 and 30 µmol/l) for MEK -1; and SB203580 (1, 5, 10 , 20 and 30 µmol/l) for p38 kinase Cytokines and pharmacological inhibitor ... tyrphostin AG490 (5 and 10 µmol/l) and Tkip (20 and 50 µmol/ l) for JAK2; LY294002 (1, and 10 µmol/l) for PI3K; PD098059 (1, 10 and 30 µmol/l) for MEK -1; and SB203580 (1, 10 and 30 µmol/l) for ... transducer and activator of transcription) and activator protein -1 [46] 10 11 As far as we are aware, this is the first report that demonstrates the cooperative interaction between leptin and IL -1 in the...
- 11
- 503
- 0
Báo cáo y học: "Dynamic compression counteracts IL-1β induced inducible nitric oxide synthase and cyclo-oxygenase-2 expression in chondrocyte/agarose constructs" pdf
... chondrocytes and superficial zone chondrocytes, and restores cell proliferation and proteoglycan synthesis [16 ,17 ] The free-swelling studies were undertaken to determine how the cytokine influenced ... with 10 ng/ml IL -1 and/ or 10 μmol/l SB203580 for 6, 12 and 48 hours The ratio of the relative expression level of iNOS was calibrated to the mean value for the unstrained (untreated) control and ... conditions or with 10 ng/ml IL1β and/ or 10 μmol/l SB203580 for 6, 12 and 48 hours The ratio of the relative expression levels of the target gene was calibrated to the mean value for the unstrained...
- 13
- 261
- 0
Heme oxygenase-1 plays a pro-life role in experimental brain stem death via nitric oxide synthase I/protein kinase G signaling at rostral ventrolateral medulla pps
... Medical Royal Colleges and their Faculties in the United Kingdom on 11 October 19 76 Br Med J 19 76, 2 :11 87 -11 88 Diagnosis of death Memorandum issued by the honorary secretary of the Conference of Medical ... read and approved the final manuscript Competing interests The authors declare that they have no competing interests 14 15 16 17 18 19 20 21 22 Received: 27 July 2 010 Accepted: September 2 010 Published: ... Science 2 010 , 17 :72 http://www.jbiomedsci.com/content /17 /1/ 72 Page of 12 and sequentially [13 -17 ,27,29] via a glass micropipette connected to a 0.5-μl Hamilton microsyringe (Reno, NV, USA) The coordinates...
- 12
- 123
- 0
Báo cáo y học: "Gender-based reciprocal expression of transforming growth factor-β1 and the inducible nitric oxide synthase in a rat model of cyclophosphamide-induced cystitis" ppsx
... NIDDK RO1-DK 06 613 8 and NIDRR grant H133E070024 References 10 11 12 13 14 15 Competing interests The authors declare that they have no competing interests 16 17 Hu RQ, Mehter H, Nadasdy T, Satoskar ... hematuria [9 ,10 ] TGF- 1 is expressed by inflammatory cells such as neutrophils and eosinophils, as well as by cells in the epithelium, fibroblasts, and smooth muscle cells [11 -13 ] These cells express ... induced cystitis: role of nitric oxide synthase, cyclooxygenase -1 and 2, and NK (1) receptors J Urol 2007, 17 7 :15 31- 1536 Hamby ME, Hewett JA, Hewett SJ: TGF-beta1 reduces the heterogeneity of astrocytic...
- 13
- 244
- 0
Báo cáo y học: "Hyaluronan modulates accumulation of hypoxiainducible factor-1 alpha, inducible nitric oxide synthase, and matrix metalloproteinase-3 in the synovium of rat adjuvant-induced arthritis model" potx
... 0 .11 2.60 ± 0 .11 2.50 ± 0 .11 2 .10 ± 0 .12 9 .10 ± 0. 31 No-tr 2.65 ± 0 .11 2.65 ± 0 .10 2.95 ± 0.05 2.20 ± 0 .12 9.75 ± 0.24 P value among groups HA P > 0.05 2.50 ± 0 .11 P > 0.05 2.70 ± 0 .11 P 0.05 P > 0.05 P 0.05 HA 2.50 ± 0 .11 2.50 ± 0 .11 b 9.55 ± 0.28 No-tr c 3D6d b 1. 40 ± 0 .11 a, b 2 .15 ± 0 .11 P
- 13
- 303
- 0
Tài liệu Báo cáo khoa học: Structural and mechanistic aspects of flavoproteins: electron transfer through the nitric oxide synthase flavoprotein domain pdf
... [58,59, 61, 90,99] [ 31 33 ,10 2 ,10 5] [28 ,10 2 ,10 5 ,11 5] [34,35] [77] [ 61, 72 ,11 6] [60] [88] [11 7] [47,48] [50 ,11 8 12 2] [49 ,12 3] [12 4 ,12 5] e a Unless otherwise stated, cytochrome c reduction and NO synthesis ... Chem 275, 612 3– 612 8 11 8 Bender AT, Silverstein AM, Demady DR, Kanelakis KC, Noguchi S, Pratt WB & Osawa Y (19 99) Neuro- 3974 11 9 12 0 12 1 12 2 12 3 12 4 12 5 12 6 12 7 12 8 nal nitric- oxide synthase is ... activation of nitric oxide synthase isozymes by calmodulin EF hand pairs FEBS J 273, 17 59 17 71 Adak S, Santolini J, Tikunova S, Wang Q, Johnson JD & Stuehr DJ (20 01) Neuronal nitric- oxide synthase...
- 16
- 639
- 0
Tài liệu Báo cáo khoa học: Polarized distribution of inducible nitric oxide synthase regulates activity in intestinal epithelial cells pdf
... superoxide Free Rad Res Commun 18 , 19 5 19 9 32 Beckman JS & Koppenol WH (19 96) Nitric oxide, superoxide, and peroxynitrite: the good, the bad, and the ugly Am J Physiol 2 71, C1424–C1437 33 Suh Y-A, Arnold ... Chem 277, 3 313 2–3 313 8 14 Baek KJ, Thiel BA, Lucas S & Stuehr DJ (19 93) Macrophage Nitric Oxide Synthase Subunits J Biol Chem 268, 211 20– 211 29 15 Albakri QA & Stuehr DJ (19 96) Intracellular assembly ... response to toll-like receptor signaling in large intestinal epithelial cells J Immunol 17 2, 30 51 3058 36 Kuo PC & Abe KY (19 95) Cytokine-mediated production of nitric oxide in isolated rat hepatocytes...
- 10
- 457
- 0
Báo cáo khoa học: Interference with the citrulline-based nitric oxide synthase assay by argininosuccinate lyase activity in Arabidopsis extracts docx
... 6, D 116 1–D 117 2 13 Adak S, Aulak KS & Stuehr DJ (2002) Direct evidence for nitrate oxide production by a nitric- oxide synthaselike protein from Bacillus subtilis J Biol Chem 277, 16 167 16 1 71 14 ... WernerFelmayer G (20 01) Nitric oxide synthase is induced in sporulation of Physarum polycephalum Genes Dev 15 , 12 99 13 09 12 Torreilles J (20 01) Nitric oxide: one of the more conserved and widespread ... + ADF Desalted extract + treated ADF Activity 16 354 ± 12 67 17 62 ± 11 9 16 085 ± 14 40 2583 ± 18 3 Fig Fumarate can replace ADF as a cosubstrate for the reaction Desalted protein extracts from Arabidopsis...
- 8
- 351
- 0
Báo cáo khoa học: Binding and activation of nitric oxide synthase isozymes by calmodulin EF hand pairs potx
... (EDTA) 10 0 93 10 0 ± 37 ± NAA 90 ± NAA NAA 10 0 ± NAA NAA 81 ± NAA NAA 10 0 ± 5± NAA 11 5 ± 4± NAA 10 0 ± 17 ± NAA 11 1 ± 43 ± NAA 10 0 ± 5± NAA 98 ± 17 ± NAA ± ± ± ± ± ± 2 FEBS Journal 273 (2006) 17 59 17 71 ... A5 21 V522 L523 F524 A525 C526 M527 L528 Glu 11, Glu14, Ala15, Leu18 C-terminal domain Central helix Val 91, Phe 91, Leu 112 Ser 81, Glu84, Ile85, Ala88, Met145 Glu 11, Phe12, Ala15, Met72 Ala15, Leu18, ... synthesis), 14 2 min )1 (NADPH oxidation) and 917 .5 min )1 (cytochrome c reduction) The activities for eNOS bound to CaM were 11 min )1 (•NO synthesis), 30 min )1 (NADPH oxidation) and 50.7 min )1 (cytochrome...
- 13
- 336
- 0
Báo cáo khoa học: Relationship between the structure of guanidines and N-hydroxyguanidines, their binding to inducible nitric oxide synthase (iNOS) and their iNOS-catalysed oxidation to NO pptx
... (19 99) Nitric oxide: chemical puzzles posed by a biological messenger Angew Chem Int Ed 38, 17 14 17 31 Alderton WK, Cooper CE & Knowles RG (20 01) Nitric oxide synthases: structure, function and ... FPhGua TolNOHG ⁄ TolGua 40 14 6 55 840 310 300 11 00 a ± ± ± ± ± ± ± 10 21 10 10 0 50 40 300 Guanidine kcat (min )1) N-Hydroxy guanidine 33 45 275 250 – – 480 410 320 780 280 350 295 ± ± ± ± ± 10 50 10 0 ... (fellowship grant to DL-G), and by National Institutes of Health (grant CA53 914 to DJS) References Stuehr DJ (19 99) Mammalian nitric oxide synthases Biochim Biophys Acta 14 11, 217 –230 Pfeiffer...
- 12
- 507
- 0
Báo cáo khoa học: Rapamycin inhibits lipopolysaccharide induction of granulocyte-colony stimulating factor and inducible nitric oxide synthase expression in macrophages by reducing the levels of octamer-binding factor-2 doc
... G-CSF in medium (ng·mL 1) A Y.-Y Chou et al E * * 12 Time (h) 10 0 80 60 40 20 24 LPS Rapa 0.2 1. 0 0.5 1. 0 1. 4 1. 7 Fold 1. 0 0.5 0.7 0.9 1. 1 Fold 0.2 10 0 * 1. 0 0.4 0.7 0.9 1. 3 Fold 0 iNOS 80 * 60 ... kinase and the transactivation and activity of the G-CSF promoter were compared between untreated cells and cells treated with 10 0 ngÆmL )1 of LPS (RAW264.7 and THP -1 cells) When inhibitors were ... macrophage activation and deactivation by lipopolysaccharide: roles of the receptor complex Pharmacol Ther 10 0, 17 1 19 4 MacMicking J, Xie QW & Nathan C (19 97) Nitric oxide and macrophage function...
- 12
- 376
- 0
Báo cáo khoa học: Proteolytic degradation of nitric oxide synthase isoforms by calpain is modulated by the expression levels of HSP90 potx
... 13 14 15 16 17 18 19 20 21 22 M Averna et al actin cytoskeleton Am J Physiol Cell Physiol 284, 15 42– 15 49 Piech A, Dessy C, Havaux X, Feron O & Balligand J (2003) Differential regulation of nitric ... EGTA, 0 .14 m NaCl, 1% Triton X -10 0, 10 lgÆmL )1 aprotinin, 20 lgÆmL )1 leupeptin, 10 lgÆmL )1 AEBSF and 10 lgÆmL )1 phosphatases inhibitor cocktail I and II, followed by brief sonication Cell lysates ... Regulation of endothelial nitric oxide synthase by the FEBS Journal 274 (2007) 611 6– 612 7 ª 2007 The Authors Journal compilation ª 2007 FEBS 612 5 Degradation of NOS isozymes by calpain 10 11 12 ...
- 12
- 338
- 0
Báo cáo khoa học: In vivo degradation of nitric oxide synthase (NOS) and heat shock protein 90 (HSP90) by calpain is modulated by the formation of a NOS–HSP90 heterocomplex pot
... 54, 11 32 11 40 20 Stalker TJ, Skvarka CB & Scalia R (2003) A novel role for calpains in the endothelial dysfunction of hyperglycemia FASEB J 17 , 15 11 15 13 21 Araujo IM, Ambrosio AF, Leal EC, Santos ... EGTA, 0 .14 m NaCl, pH 7.4 (immunoprecipitation buffer), containing 1% Triton X -10 0, 10 lgÆmL )1 aprotinin, 20 lgÆmL )1 leupeptin, 10 lgÆmL )1 AEBSF and phosphatase inhibitor cocktail I and II (10 lgÆmL )1) , ... nitric- oxide synthase in vitro and in vivo J Biol Chem 275, 17 407 17 411 17 Gamerdinger M, Manthey D & Behl C (2006) Oestrogen receptor subtype-specific repression of calpain expression and calpain...
- 11
- 344
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25