Phân lập và tạo dòng gen mã hóa chitinase từ vi khuẩn bacillus sp

ĐẠI HỌC ĐÀ NẴNG TRƢỜNG ĐẠI HỌC SƢ PHẠM KHOA SINH MƠI TRƢỜNG KHĨA LUẬN TỐT NGHIỆP PHÂN LẬP VÀ TẠO DÕNG GEN MÃ HÓA CHITINASE TỪ VI KHUẨN BACILLUS SP TRỊNH THỊ PHƢƠNG THẢO Đà Nẵng, năm 2020 ĐẠI HỌC ĐÀ NẴNG TRƢỜNG ĐẠI HỌC SƢ PHẠM KHOA SINH MƠI TRƢỜNG KHĨA LUẬN TỐT NGHIỆP PHÂN LẬP VÀ TẠO DÕNG GEN MÃ HÓA CHITINASE TỪ VI KHUẨN BACILLUS SP Ngành: Cơng nghệ sinh học Khóa: 2016 - 2020 Sinh viên: Trịnh Thị Phƣơng Thảo Ngƣời hƣớng dẫn: ThS Vũ Đức Hoàng Đà Nẵng, năm 2020 LỜI CAM ĐOAN Tơi cam đoan liệu trình bày khóa luận trung thực Đây kết nghiên cứu chưa công bố cơng trình khác trước Tơi hồn tồn chịu trách nhiệm vi phạm quy định đạo đức khoa học Sinh viên Trịnh Thị Phƣơng Thảo i LỜI CẢM ƠN Để hoàn thành khóa luận tốt nghiệp này, tơi xin bày tỏ lời biết ơn chân thành đến ThS Vũ Đức Hoàng TS Nguyễn Đức Huy tận tình giúp đỡ, truyền đạt kiến thức tạo điều kiện tốt suốt q trình thực hồn thành khóa luận Tôi xin chân thành cảm ơn ThS Lê Mỹ Tiểu Ngọc Kỹ sƣ Nguyễn Chính Thành trực tiếp hƣớng dẫn cho tơi, tận tình giúp đỡ truyền đạt kinh nghiệm tơi q trình nghiên cứu Tôi xin gửi lời cảm ơn thầy cô giáo Khoa Sinh – Môi trƣờng, Trƣờng Đại học Sƣ phạm, Đại học Đà Nẵng giúp đỡ, hỗ trợ tạo điều kiện tốt để thực đề tài tận tình giảng dạy, truyền đạt kiến thức cho học tập năm đại học Cuối cùng, xin gửi lời cảm ơn đến gia đình, bạn bè ln giúp đỡ động viên tơi suốt thời gian làm khóa luận Tơi xin chân thành cảm ơn! Đà Nẵng, ngày tháng năm 2020 Sinh viên Trịnh Thị Phƣơng Thảo ii MỤC LỤC LỜI CAM ĐOAN i LỜI CẢM ƠN ii MỤC LỤC iii DANH MỤC CHỮ VIẾT TẮT v DANH MỤC BẢNG BIỂU vi DANH MỤC HÌNH vii TÓM TẮT ix MỞ DẦU 1 TÍNH CẤP THIẾT CỦA ĐỀ TÀI MỤC TIÊU ĐỀ TÀI Ý NGHĨA CỦA ĐỀ TÀI 3.1 Ý nghĩa khoa học 3.2 Ý nghĩa thực tiễn NỘI DUNG NGHIÊN CỨU CHƢƠNG TỔNG QUAN TÀI LIỆU 1.1 TỔNG QUAN VỀ BACILLUS SP 1.2 TỔNG QUAN VỀ CHITINASE 1.2.1 Giới thiệu chitinase 1.2.2 Phân loại chitinase 1.2.3 Cấu trúc chitinase 1.2.4 Cơ chế thủy phân chitin 10 1.2.5 Nguồn thu nhận chitinase 11 1.2.6 Ứng dụng chitinase 12 1.3 TÌNH HÌNH NGHIÊN CỨU VỀ CHITINASE 16 1.3.1 Một số nghiên cứu nƣớc 16 1.3.2 Một số nghiên cứu giới 17 CHƢƠNG VẬT LIỆU VÀ PHƢƠNG PHÁP NGHIÊN CỨU 21 2.1 VẬT LIỆU 21 2.2 PHƢƠNG PHÁP NGHIÊN CỨU 21 2.2.1 Phân lập vi khuẩn Bacillus sp 21 iii 2.2.2 Xác định đặc điểm hình thái, sinh lý sinh hóa 22 2.2.3 Xác định hoạt tính chitinase chủng Bacillus sp 23 2.2.4 Tách chiết DNA tổng số 24 2.2.5 Định danh vi khuẩn kỹ thuật sinh học phân tử 24 2.2.6 Khuếch đại PCR gen mã hóa chitinase 25 2.2.7 Tạo dòng gen mã hóa chitinase vào vector pGEM®-T Easy 26 2.2.8 Giải trình tự gen mã hóa chitinase 26 2.2.9 Phƣơng pháp xử lý số liệu 27 CHƢƠNG KẾT QUẢ VÀ THẢO LUẬN 28 3.1 PHÂN LẬP VI KHUẨN BACILLUS SP 28 3.2 XÁC ĐỊNH CÁC ĐẶC ĐIỂM SINH LÝ VÀ SINH HÓA 30 3.3 XÁC ĐỊNH HOẠT TÍNH CHITINASE TỪ CÁC CHỦNG BACILLUS SP 32 3.4 TÁCH CHIẾT DNA TỔNG SỐ 34 3.5 ĐỊNH DANH VI KHUẨN BẰNG KỸ THUẬT SINH HỌC PHÂN TỬ 35 3.6 KHUẾCH ĐẠI PCR GEN MÃ HÓA CHITINASE 35 3.7 TẠO DÒNG GEN MÃ HĨA CHITINASE VÀO VECTOR pGEM®-T EASY 37 3.8 TRÌNH TỰ GEN MÃ HÓA CHITINASE 40 KẾT LUẬN VÀ KIẾN NGHỊ 45 KẾT LUẬN 45 KIẾN NGHỊ 45 TÀI LIỆU THAM KHẢO 46 Tài liệu Tiếng Việt 46 Tài liệu Tiếng Anh 47 PHỤ LỤC 55 iv DANH MỤC CHỮ VIẾT TẮT Bp Base pair Cs cộng DNA Deoxyribonucleic acid EDTA Ethylene diamine tetra-acetic acid GH glycosyl hydrolase GlcNAc N-acetyl-D-glucosamine IPTG Isopropyl β-D-1-thiogalactopyranoside LB Luria bertani (môi trƣờng Luria bertani) MMHL Minimal Medium recommended by Hsu and Lockwood NCBI National Center for Biotechnology Information (Trung tâm thông tin công nghệ sinh học Quốc gia Hoa Kỳ) PCI Phenol : chloroform : isoamylalcohol PCR Polymerase chain reaction (Phản ứng chuỗi polymerase) TAE Tris-acetate-EDTA TE Tris-EDTA X-gal 5-Bromo-4-Chloro-3-Indolyl-DGalactopyranoside v DANH MỤC BẢNG BIỂU Bảng Tên bảng Trang 2.1 Trình tự mồi đƣợc dùng để khuếch đại gen 16S rRNA 25 2.2 Trình tự mồi đƣợc dùng để khuếch đại gen chitinase 25 2.3 Trình tự mồi đƣợc dùng để giải trình tự gen chitinase 27 3.1 3.2 Đặc điểm hình thái khuẩn lạc, hình thái tế bào Gram củng vi khuẩn Khả sinh tổng hợp chitinase chủng Bacillus sp vi 29 33 DANH MỤC HÌNH Hình 1.1 Tên hình Cấu trúc mơ đun họ glycol hydrolase 18 vi khuẩn khác cấu trúc ba chiều ChiA74 từ B thuringiensis Trang 1.2 Vị trí phân cắt chitin chitinase 10 2.1 Vector pGEM®-T Easy 21 3.1 Hình thái khuẩn lạc chủng vi khuẩn 28 3.2 Hình thái tế bào chủng vi khuẩn sau nhuộm Gram 30 3.3 3.4 3.5 Hình ảnh thử hoạt tính sinh tổng hợp catalase chủng vi khuẩn Hình ảnh thể khả di động chủng vi khuẩn Hình ảnh thử hoạt tính sinh tổng hợp oxidase chủng vi khuẩn 30 31 32 3.6 Vòng halo thể hoạt tính chitinase chủng Bacillus sp 33 3.7 Hình ảnh điện di DNA tổng số chủng TB1 34 3.8 Hình ảnh điện di sản phẩm khuếch đại PCR trình tự 16S rRNA 35 3.9 3.10 3.11 3.12 3.13 3.14 Hình ảnh điện di sản phẩm khuếch đại PCR gen mã hóa chitinase Hình ảnh điện di tinh sản phẩm PCR gen chitinase từ Bacillus sp TB1 Thể biến nạp mơi trƣờng LB rắn có bổ sung ampicillin, X-gal, IPTG Hình ảnh điện di sản phẩm PCR khuẩn lạc màu trắng đĩa môi trƣờng chọn lọc Hình ảnh điện di kiểm tra vector tái tổ hợp pGEM®-T Easy /chitinase Trình tự nucleotide gen mã hóa chitinase phân lập từ Bacillus sp TB1 vii 36 36 37 38 39 40 3.15 3.16 3.17 Trình tự amino acid suy diễn gen chitinase chủng Bacillus sp TB1 Cấu trúc vùng protein suy diễn từ gen mã hóa chitinase Mơ hình cấu trúc khơng gian chiều chitinase từ chủng Bacillus sp TB1 41 41 42 Kết so sánh trình amino acid suy diễn gen mã hóa chitinase 3.18 chủng Bacillus sp TB1 với B subtilis HDZK-BYSB7, B cereus SV1, B thuringiensis serovar kurstaki MSS1.1 viii 43 KẾT LUẬN VÀ KIẾN NGHỊ KẾT LUẬN Trên sở kết thu đƣợc, rút số kết luận sau đây: Phân lập đƣợc chủng Bacillus sp từ mẫu nƣớc thải chế biến thủy sản nƣớc thải hồ ni tơm Trong đó, chủng Bacillus sp TB1 có hoạt tính tính chitinase mạnh với đƣờng kính vịng phân giải 13 mm Trình tự 16S rRNA chủng Bacillus sp TB1 có chiều dài 1423 bp đăng ký ngân hàng GenBank với mã số MT750324 Khuếch đại thành công gen chitinase từ DNA tổng số chủng Bacillus sp TB1 cặp mồi đặc hiệu, sản phẩm PCR có kích thƣớc khoảng 2kb Tạo dịng thành cơng gen chitinase vào vector pGEM®-T Easy Gen mã hóa chitinase đƣợc giải trình tự nucleotide thành cơng, gen có kích thƣớc 2025 bp đăng ký ngân hàng GenBank với mã số MT633090 Gen mã hóa protein dài 674 amino acid Phân tích cấu trúc dự đốn protein suy diễn từ gen mã hóa chitinase từ chủng Bacillus sp TB1 cho thấy chitinase thuộc nhóm glycosyl hydrolase 18 Cấu trúc protein gồm vùng: vùng hoạt động (vùng thủy phân) đầu N, vùng Fibronectin (FnIII), cuối vùng gắn kết chitin (Chitin Binding Domain: CBD) đầu C Cấu trúc bậc dựa đốn chitinase có 15 vị trí gập cuộn xoắn α 23 vị trí gập cuộn phiến β KIẾN NGHỊ Trong khóa luận này, tơi tạo dịng thành cơng gen chitinase vào vector pGEM®-T Easy Việc tạo dòng bƣớc mở đầu để đến biểu gen tối ƣu điều kiện biểu Do đó, tơi xin kiến nghị: Tạo dịng biểu biểu gen chitinase vật chủ thích hợp Tối ƣu hóa điều kiện biểu sản xuất chitinsae tái tổ hợp quy mơ phịng thí nghiệm 45 TÀI LIỆU THAM KHẢO Tài liệu Tiếng Việt Đỗ Thị Thanh Dung, Lê Thanh Bình, Hồng Thị Đăng Dƣơng, Võ Đình Quang Phan Thị Phƣợng Trang (2017), Tuyển chọn chủng vi khuẩn Bacillus spp sinh enzyme kháng Vibrio parahaemolyticus gây hội chứng chết sớm (EMS) tơm, Tạp chí phát triển khoa học & cơng nghệ, 1(6): 23-31 Nguyễn Lân Dũng, Nguyễn Đình Quyến Phạm Văn Ty (2000), Vi sinh vật học, Nhà xuất Giáo dục Trịnh Thị Thu Hà, Đồng Văn Quyền, Đặng Văn Tiến Ngơ Đình Bính (2014), Phân lập gen mã hóa endochitinase từ vi khuẩn Bacillus thuringiensis serovar kurstaki Hà Nội, Tạp chí Cơng nghệ Sinh học, 12(4): 757-763 Trịnh Thị Thu Hà, Đồng Văn Quyền Ngơ Đình Bính (2017), Biểu tinh chitinase từ Bacillus thuringiensis serovar kurstaki vi khuẩn Escherichia coli, Tạp chí Cơng nghệ Sinh học, 15(3): 571-579 Ðinh Minh Hiệp (2007), Chitinase Trichoderma vai trị kiểm sốt sinh học, Báo cáo chuyên đề nghiên cứu sinh, Trƣờng Ðại học Khoa học Tự nhiên Thành phố Hồ Chí Minh Chu Thị Hoa (2012), Tách dịng biểu gene mã hóa chitinase B licheniformis KNUC213 Pichia pastoris, Viện Khoa học Công nghệ Việt Nam – Viện Sinh thái Tài nguyên sinh vật, Hà Nội Phạm Thu Hƣơng, Lê Thị Thủy, Đinh Nho Thái Nguyễn Thị Hồng Loan (2017), Nghiên cứu tinh xác định số tính chất catalase từ Bacillus subtilis PY79, Tạp chí Khoa học ĐHQGHN: Khoa học Tự nhiên Công nghệ, 33(1S): 268-276 Phạm Thị Ngọc Lan Hoàng Quốc Anh (2010), Tuyển chọn chủng vi khuẩn phân hủy chitin khảo sát điều kiện sinh tổng hợp chitinase, Tạp chí Cơng nghệ Sinh học, 8(3B): 1639-1643 Nguyễn Thị Liên, Nguyễn Thị Yến Nhƣ, Trần Thị Xuân Mai Nguyễn Thị Pha (2016), Phân lập tuyển chọn vi khuẩn từ đất vùng rễ ớt có khả đối kháng với nấm 46 Colletotrichum sp gây bệnh thán thƣ ớt, Tạp chí Khoại học Trường Đại học Cần Thơ, 47(2016): 16-23 10 Nguyễn Đức Lƣợng (2002), Thí nghiệm cơng nghệ sinh học, NXB Đại học Quốc gia Tp Hồ Chí Minh 11 Nguyễn Văn Nam, Nguyễn Thị Thanh, Nguyễn Anh Dũng Ro Dong Park (2010), Chức chitinase nấm Trichoderma hazianum T1 trình đối kháng với nấm bệnh Fusarium solani, Tạp chí Cơng nghệ Sinh học, 8(3B): 1633-1638 12 Trần Đình Toại, Nguyễn Văn Thiết, Nguyễn Bích Thủy Đỗ Trung Sỹ (2008), Nghiên cứu động học q trình hoạt hóa chitinase phản ứng thủy phân chitin thành glucosamine, Tạp chí Khoa học Cơng nghệ, 46(1): 79-85 13 Nguyễn Thị Thu Trang Nguyễn Lân Dũng (2006), Khả sinh tổng hợp chitinaza chủng vi khuẩn Bacillus Q3 có hoạt tính kháng nấm cao, Tạp chí Sinh học, 28(2): 8285 14 Quách Ngọc Tùng, Nguyễn Văn Hiếu Phí Quyết Tiến (2013), Biểu gen mã hóa chitinase Bacillus licheniformis KNUC213 Escherichia coli, Kỷ yếu Hội nghị Cơng nghệ sinh học tồn quốc Nhà xuất Khoa học Công nghệ Tài liệu Tiếng Anh 15 Ajayi A.A., Onibokun E.A., George F.O.A., and Atolagbe O.M (2016), Isolation and characterization of chitinolytic bacteria for chitinase production from the African catfish, clarias gariepinus (Burchell, 1822), Research Journal of Microbiology, 11(4-5): 119-125 16 Barboza-Corona J.E., Nieto-Mazzocco E., Velázquez-Robledo R., Salcedo-Hernandez R., Bautista M., Jiménez B., and Ibarra J.E (2003), Cloning, Sequencing, and Expression of the Chitinase Gene chiA74 from Bacillus thuringiensis, Applied and Environmental Microbiology, 69(2): 1023-1029 17 Barboza-Corona J.E., Reyes-Rios D.M., Salcedo-Hernández R., and Bideshi D (2008), Molecular and biochemical characterization of an endochitinase (ChiA-HD73) from Bacillus thuringiensis subsp kurstaki HD-73, Molecular Biotechnology, 39: 29-37 18 Bhattachrya D., Nagpure A., and Gupta R.K (2007), Bacterial chitinase: Properties and potential, Critical Reviews in Biotechnology, 27(1): 21-28 47 19 Breman J.G and Brandling-Bennett A.D (2011), The challenge of malaria eradication in the twenty-first century: research linked to operations is the key, Vaccine, 29(4): 97-103 20 Buchanon R E and Gibbons N E (1989), Bergey’s Manual of Determinative Bacteriology, The Williams and Wilkins company, Baltimore 21 Bussink A P., Eijk M., Renkema G H., Aerts J M., and Boot R G (2006), The biology of the Gaucher cell: the cradle of human chitinases, International Review of Cytology, 252: 71-128 22 Cai Y., Yan J., Hu X., Han B., and Yuan Z (2007), Improving the Insecticidal Activity against Resistant Culex quinquefasciatus Mosquitoes by Expression of Chitinase Gene chiAC in Bacillus sphaericus, Applied and Environmental Microbiology, 73(23): 77447746 23 Castillo B.M., Dunn M.F., Navarro K.G., Meléndez F.H., Ortiz M.H., Guevara S.E., and Palacios G.H (2016), Antifungal performance of extracellular chitinases and culture supernatants of Streptomyces galilaeus CFFSUR-B12 against Mycosphaerella fjiensis Morelet, World Journal of Microbiology and Biotechnology, 32: 44 24 Dahiya N., Tewari R., Tiwari R.P., and Hoondal G.S (2005), Production of an Antifungal Chitinase from Enterobacter sp NRG4 and its Application in Protoplast Production, World Journal of Microbiology and Biotechnology, 21(8): 1611-1616 25 Deng J.J., Shi D., Mao H.H., Li Z.W., Liang S., Ke Y., and Luo X.C (2019), Heterologous expression and characterization of an antifungal chitinase (Chit46) from Trichoderma harzianum GIM 3.442 and its application in colloidal chitin conversion, International Journal of Biological Macromolecules, 134: 113–121 26 Devi C.S., Srinivasan V.M., Archana B., Roy S.S., and Naine S.J (2015), Production and partial purification of antifungal chitinase from Bacillus cereus VITSD3, Bioscience Journal, 21(3): 960-968 27 Du C and Webb C (2011), Cellular Systems, Comprehensive Biotechnology, 11-23 28 Duo-Chuan L (2006), Review of fungal chitinases, Mycopathologia, 161(6): 345-360 29 Ghorbel-Bellaaj O., Manni L., Jellouli K., Hmidet N., and Nasr M (2012), Optimization of protease and chitinase productionby Bacillus cereus SV1 on shrimp shell waste using 48 statistical experimental design Biochemical and molecularcharacterization of the chitinase, Annals of Microbiology, 62: 1255–1268 30 Gupta N., Kumar A., Laksh, Angural S., and Rana M (2017), Process optimization of extracellular chitinase production from Bacillus sp isolated from fish waste dumping site, European journal of pharmaceutical and medical research, 4(9): 474-480 31 Haggag W.M and Abdallh E.G (2012), Purification and characterization of chitinase produced by endophytic Streptomyces hygroscopicusagainst some phytopathogens, Journal of Microbiology Research, 2(5): 145-151 32 Hamid R., Khan M.A., Ahmad M., Ahmad M.M., Abdin M.Z., Musarrat J., and Javed S (2013), Chitinases: an update, Journal of Pharmacy and Bioallied Sciences, 5: 21 33 Han B., Zhou K., Li Z., Sun B., Ni Q., and Meng X (2016 ), Characterization of the First Fungal glycosyl hydrolase family 19 Chitinase (NbchiA) from Nosema bombycis (Nb) J Eukaryot, Microbiology, 63: 37–45 34 Harman G.E (2000), Myths and dogmas of biocontrol, Plant Disease, 84(7): 377–391 35 Honda S., Kunii T., Nohara K., Wakita S., Sugahara Y., Kawakita M., Oyama F., and Sakaguchi M (2017), Characterization of a Bacillus thuringiensis chitinase that binds to cellulose and chitin, Applied Microbiology and Biotechnology, 7(1): 51 36 Hongkulsup C., Khutoryanskiy V., and Niranjan K (2016), Enzyme assisted extraction of chitin from shrimp shells (Litopenaeus vannamei), Journal of Chemical Technology and Biotechnology, 91(5): 1250-1256 37 Islam S Md A., Cho K.M., Hong S J., Math R K., Kim J M., Yun M G., Cho J J., Heo J Y., Lee Y H., Kim H., and Yun H.D (2010), Chitinase of Bacillus licheniformis from oyster shell as a probe to detect chitin in marine shells, Applied Microbiology and Biotechnology, 86: 119-129 38 Itoh T and Kimoto H (2019), Bacterial chitinase system as a model of chitin biodegradation, Springer, Singapore: 131–151 39 Jahromi S.T and Barzkar N (2018), Marine bacterial chitinase as sources of energy, eco-friendly agent, and industrial biocatalyst, International Journal of Biological Macromolecules, 120(Pt B): 2147-2154 49 40 Jenifer S., Jeyasree J., Kezia Laveena D., and Manikandan K (2014), Purification and characterization of chitinase from Trichoderma viride N9 and its antifungal activity against phytopathogenic fungi, World Journal of Pharmacy and Pharmaceutical sciences 3(12): 1604-1611 41 Juárez-Hernández E O., Casados-Vázquez L E., Brieba L G., Torres-Larios A., Jimenez-Sandoval P., and E Barboza-Corona J (2019), The crystal structure of the chitinase ChiA74 of Bacillus thuringiensis has a multidomain assembly, Scientific Reports, 2019: 1-10 42 Karasuda S., Kajihara H., Yamamoto Y , and Koga D (2003), Plant chitinase as a possible biocontrol agent for use instead of chemical fungicides, Bioscience, biotechnology, and biochemistry, 67: 221-224 43 Kelley L A., Mezulis S., Yates C M., Wass M N., and Sternberg M J E (2015), The Phyre2 web portal for protein modeling, prediction and analysis, Nature Protocols, 10(6): 845-858 44 Kezuka Y., Ohishi M., Itoh Y., Watanabe J., Mitsutomi M., and Watanabe T (2006), Structural Studies of a Two-domain Chitinase from Streptomyces griseus HUT6037, Journal of Molecular Biology, 358: 472–484 45 Kusaoke H., Shinya S., Fukamizo T., and Kimoto H (2017), Biochemical and biotechnological trends in chitin, chitosan, and related enzymes produced by Paenibacillus IK-5 Strain., International Journal of Biological Macromolecules, 104: 1633–1640 46 Kuzu S.B., Guvenmez H.K., and Denizci A.A (2012), Production of a thermostable and alkaline chitinase by Bacillus thuringiensis sp kurstaki strain HBK-51, Biotechnology Research International, 2012: 1-6 47 Le B and Yang S.H (2018), Characterization of a chitinase from Salinivibrio sp BAO1801 as an antifungal activity and a biocatalyst for producing chitobiose, Journal of Basic Microbiology, 58: 848–856 50 48 Lee Y S., Cho Y S., Park I H., Yoo J S., Chung S Y , Lee Y C., Ahn S C., Kim C M., and Choi Y L (2007), Cloning, purification, and characterization of chitinase from Bacillus sp DAU101, Bioresource Technology, 98: 2734–2741 49 Letunic I and Bork P (2017), 20 years of the SMART protein domain annotation resource., Nucleic Acids Res, 46(D1): D493-D496 50 Li H and Greene L H (2010), Sequence and structural analysis of the chitinase insertion domain reveals two conserved motifs involved in chitin-binding, PLoS One, 5(1): e8654 51 Liu J., NanGong Z., Zhang J., Song P., Tang Y., Gao Y., and Wang Q (2019), Expression and characterization of two chitinases with synergistic efect and antifungal activity from Xenorhabdus nematophila., World Journal of Microbiology and Biotechnology, 35(105) 52 Loc N.H., Quang H.T., Hung N.B., Huy N.D., Phuong T.T.B., and Ha T.T.T (2011), Trichoderma asperellum Chi42 Genes Encode Chitinase, Mycobiology, 39(3): 182-186 53 Lombard V., Golaconda Ramulu H., Drula E., Coutinho P.M., and Henrissat B (2014), The carbohydrate-active enzymes database (CAZy) in 2013, Nucleic Acids Research, 42: 490-495 54 Muzzarelli R.A (2013), Chitin, Elsevier, Kent 55 Narayanan K., Krthika A., and Parameswaran B (2014), Production, purification and properties of fungal chitinases - A review, Indian Journal of experimential Biology, 52: 1025-1035 56 Nasseri A., Rasoul-Amini S., Morowvat M., and Ghasemi Y (2011), Single cell protein: production and process, American Journal of Food Technology, 6: 103–116 57 Pan M., Li J., Lv X., Du G., and Liu L (2019), Molecular engineering of chitinase from Bacillus sp DAU101 for enzymatic production of chitooligosaccharides, Enzyme and Microbial Technology, 124: 54–62 58 Patil N.S and Jadhav J.P (2014), Enzymatic production of N-acetyl-D-glucosamine by solid state fermentation of chitinase by Penicillium ochrochloron MTCC 517 using agricultural residues, International Biodeterioration & Biodegradation, 91(2014): 917 51 59 Patricia S and Laura C (2010), Oxidase test protocol, American Society for Microbiology 60 Petersen T.N., Brunak S., Heijne G.V., and Nielsen H (2011), SignalP 4.0: discriminating signal peptides from transmembrane regions, Nature Methods, 8: 785786 61 Rajan L.A., Dharini J, Singh K.H.P, Sivvaswaamy S.N., Sheela S.J, and Sundar N (2010), Identification, Cloning and Sequence Analysis of Chitinase Gene in Bacillus halodurans Isolated from Salted fish, Biotechnology, 9(2): 229-233 62 Rathore A S and Gupta R D (2015), Chitinases from Bacteria to Human: Properties, Applications, and Future Perspectives, Enzyme Research, 2015: 1-8 63 Rodríguez M., Ana Marín A., Marta Torres M., Béjar V., Campos M., and Sampedro I (2018), Aphicidal Activity of Surfactants Produced by Bacillus atrophaeus L193, Original Research, 9: 1-12 64 Rosovitz M J., Voskuil M I., and Chambliss G H (1998), Bacillus, in Systematic Bacteriology, Arnold Press, London 65 Saleem F., Shakoori A R., Younas A., Bashir R., Naz S., and Muni N (2014), Molecular Cloning and Characterization of Exochitinase A Gene of Indigenous Bacillus thuringiensis Isolates, Pakistan Journal of Zoology, 46(6): 1491-1501 66 Sambrook S and Russell D W (2003), Molecular Cloning: A Laboratory Manual Cold Spring Harbor: New York 177-182 67 Shahidi F and Abuzaytoun R (2005), Chitin, chitosan, and co-products: chemistry, production, applications, and health effects, Advances in Food and Nutrition Research, 49: 93-135 68 Sharma R., Singh D., and Singh R (2009), Biological control of postharvest diseases of fruits and vegetables by microbial antagonists: a review, Biological Control, 50: 205– 221 69 Sheila A., Martínez-Zavala, Barboza-Pérez U E., Hernández-Guzmán G., Bideshi D K., Barboza-Corona, and José E (2020), Chitinases of Bacillus thuringiensis: Phylogeny, Modular Structure, and Applied Potentials, Frontiers in Microbiology, 10: 1-15 52 70 Shubakov A.A and Kucheryavykh P.S (2004), Chitinolytic Activity of Filamentous Fungi, Applied Biochemistry and Microbiology, 40(5): 445-447 71 Singh G., Bhalla A., Bhatti J.S., Chandel S., Rajput A., and Abdullah A (2014), Potential of chitinases as a biopesticide against agriculturally harmful fungi and insects, Research & Reviews: Journal of Microbiology and Biotechnology, 3: 27-32 72 Srivastava D.B., Ethayathulla A.S., Kumar J., Singh N., and Sharma S (2006), Crystal structure of a secretory signalling Glycol-protein from sheep at 2.0 Å resolution, Journal of Structural Biology, 156: 505-516 73 Swiontek B.M., Jankiewicz U., Burkowska A , and Walczak M (2014), Chitinolytic microorganisms and their possible application in environmental protection, Current Microbiology, 68: 71-81 74 Thomas C.J., Gooday G.W., King L.A., and Possee R.D (2000), Mutagenesis of the active site coding region of the Autographa californica nucleopolyhedrovirus chiA gene, Journal of General Virology, 81(5): 1403-1411 75 Umemoto N., Kanda Y., Ohnuma T., Osawa T., Numata T., and Sakuda S (2015), Crystal structures and inhibitor binding properties of plant class v chitinases: The cycad enzyme exhibits unique structural and functional features, The Plant Journal, 82: 54–66 76 Usharani T R and Gowda T.K S (2011), Cloning of chitinase gene from Bacillus thuringiensis, Indian Journal of Biotechnology, 10: 264-269 77 Vaaje-Kolstad G., Horn S.J., Sørlie M., and Eijsink V.G.H (2013), The chitinolytic machinery of Serratia marcescens - A model system for enzymatic degradation of recalcitrant polysaccharides, The FEBS Journal, 280: 3028–3049 78 Wang D., Li A., Han H., Liu T., and Yang Q (2018), A potent chitinase from Bacillus subtilis for the efficient bioconversion of chitin-containing wastes, International Journal of Biological Macromolecules, 116: 863-868 79 Wilson K (2001), Preparation of Genomic DNA from Bacteria, Current Protocols in Molecular Biology, 51(1): 241-245 53 80 Yang C.Y., Ho Y.C., Pang J.C., Huang S.S., and Tschen J.S (2009), Cloning and expression of an antifungal chitinase gene of a novel Bacillus subtilis isolate from Taiwan potato field, Bioresource Technology, 100(3): 1454-1458 81 Yuli P.E., Suhartono M.T., Rukayadi Y., Hwang J.K., and Pyunb Y.R (2004), Characteristics of thermostable chitinase enzymes from the Indonesian Bacillus sp.13.26, Enzyme and Microbial Technology, 35: 147–153 54 PHỤ LỤC Phụ lục Trình tự 16S rRNA chủng Bacillus sp TB1 đăng ký ngân hàng Genbank mã số MT750324 LOCUS DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM MT750324 1423 bp DNA linear BCT 15-JUN-2020 Bacillus sp (in: Bacteria) strain TB1 16S ribosomal RNA gene, partial sequence MT750324 Bacillus sp (in: Bacteria) Bacillus sp (in: Bacteria) Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus REFERENCE (bases to 1423) AUTHORS Hoang,V.D., Trang,L.V.K., Lan,T.T.P., Thao,T.T.P and Thoa,L.T.K TITLE Isolation Bacillus sp TB1 from aquculture waste water and cloning chitinase encoding gene JOURNAL Journal of Science, The University of Danang, University of Education (2020) In press REFERENCE (bases to 1423) AUTHORS Hoang,V.D., Thao,T.T.P., Thoa,L.T.K., Trang,L.V.K and Huy,N.D TITLE Direct Submission JOURNAL Submitted (15-JUN-2020) University of Science and Education, The University of Danang, 459 Ton Duc Thang, Danang, Danang 550000, Viet Nam COMMENT Bankit Comment: ALT EMAIL:nguyenhuy147@gmail.com Bankit Comment: Submission Title:Bacillus sp TB1 16S rRNA ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1423 /organism="Bacillus sp (in: Bacteria)" /mol_type="genomic DNA" /strain="TB1" /isolation_source="Aquaculture wastewater" /db_xref="taxon:1409" /country="Viet Nam" rRNA 1423 /product="16S ribosomal RNA" BASE COUNT 364 a 327 c 434 g 298 t 55 ORIGIN 61 121 181 241 301 361 421 481 541 601 661 721 781 841 901 961 1021 1081 1141 1201 1261 1321 1381 tgcaagtcga taacacgtgg ggataacatt atggacccgc agccgacctg gaggcagcag gtgatgaagg taagctggca gcggtaatac ggtttcttaa gagacttgag tatggaggaa aagcgtgggg taagtgttag gggagtacgg agcatgtggt aaccctagag cagctcgtgt tgccatcatt gatgacgtca tacaaagagc ttgtaggctg cgcggtgaat cacccgaagt gcgaatggat gtaacctgcc ttgaaccgca gtcgcattag agagggtgat tagggaatct ctttcgggtc ccttgacggt gtaggtggca gtctgatgtg tgcagaagag caccagtggc agcaaacagg agggtttccg ccgcaaggct ttaattcgaa atagggcttc cgtgagatgt tagttgggca aatcatcatg tgcaagaccg caactcgcct acgttcccgg cggtggggta taagagcttg cataagactg tggttcgaaa ctagttggtg cggccacact tccgcaatgg gtaaaactct acctaaccag agcgttatcc aaagcccacg gaaagtggaa gaaggcgact attagatacc ccctttagtg gaaactcaaa gcaacgcgaa tccttcggga tgggttaagt ctctaaggtg ccccttatga cgaggtggag acatgaagct gccttgtaca accttttgga // 56 ctcttatgaa ggataactcc ttgaaaggcg aggtaacggc gggactgaga acgaaagtct gttgttaggg aaagccacgg ggaattattg gctcaaccgt ttccatgtgt ttctggtctg ctggtagtcc ctgaagttaa ggaattgacg gaaccttacc gcagagtgac cccgcaacga actgccggtg cctgggctac ctaatctcat ggaatcgcta caccgcccgt gccagccgcc gttagcggcg gggaaaccgg gcttcggctg tcaccaaggc cacggcccag gacggagcaa aagaacaagt ctaactacgt ggcgtaaagc ggagggtcat agcggtgaaa taactgacac acgccgtaaa cgcattaagc ggggcccgca aggtcttgac aggtggtgca gcgcaaccct acaaaccgga acacgtgcta aaaaccgttc gtaatcgcgg cacaccacga taa gacgggtgag ggctaatacc tcacttatgg aacgatgcgt actcctacgg cgccgcgtga gctagttgaa gccagcagcc gcgcgcaggt tggaaactgg tgcgtagaga tgaggcgcga cgatgagtgc actccgcctg caagcggtgg atcctctgac tggttgtcgt tgatcttagt ggaaggtggg caatggacgg tcagttcgga atcagcatgc gagtttgtaa Phụ lục Trình tự nucleotide gen mã hóa chitinase chủng Bacillus sp TB1 đăng ký ngân hàng GenBank mã số MT633090 LOCUS DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM MT633090 2025 bp DNA linear BCT 15-JUN-2020 Chitinase encoding gene from Bacillus sp strain TB1, complete CDS MT633090 Bacillus sp (in: Bacteria) Bacillus sp (in: Bacteria) Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus REFERENCE (bases to 2025) AUTHORS Hoang,V.D., Trang,L.V.K., Lan,T.T.P., Thao,T.T.P and Thoa,L.T.K TITLE Isolation Bacillus sp TB1 from aquculture waste water and cloning chitinase encoding gene JOURNAL Journal of Science, University of Education, The University of Danang, (2020) In press REFERENCE (bases to 2025) AUTHORS Hoang,V.D., Thao,T.T.P., Thoa,L.T.K., Trang,L.V.K and Huy,N.D TITLE Direct Submission JOURNAL Submitted (15-JUN-2020) Institute of Biotechnology, Hue University, Provincial Highway 10, Phu Thuong, Phu Vang, Thua Thien Hue 530000, Vietnam COMMENT Bankit Comment: ALT EMAIL:hoangvuduc779@gmail.com Bankit Comment: TOTAL # OF SEQS:1 ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 2025 /organism="Bacillus sp (in: Bacteria)" /mol_type="genomic DNA" /strain="TB1" /isolation_source="Aquaculture wastewater" /db_xref="taxon:1409" /note="[cultured bacterial source]" CDS 2025 /EC_number="3.2.1.14" /note="Chitin hydrolytic enzyme" /codon_start=1 /transl_table=11 /product="Chitinase" /translation="MRSKKFTLLLLSLLLFLPLFLTNFITPNVVLADSQKQGQKIVGY FPSWGIYGRNYQVADIDASKLTHLNYAFADICWNGKHGNPSTHPDNPNKQTWNCKESG VPLQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDKYARCGNFGELKRLKAKYPHL 57 KTIISVGGWTWSNRFSDMAADEKTRKVFADSTVDFLREYGFDGVDLDWEYPGVETIPG GSYRPEDKQSFTLLLQDVRNALTKAGAEDGKQYLLTIASGASQRYADHTELKKISQIL DWINIMTYDFHGGWEATSNHNAALYKDPNDPAADTKFYVDGAIDIYTNEGVPADKLVL GVPFYGRGWKSCGKENNGQYQPCKPGSDGKLASKGTWDDYSTGDTGVYDYGDLAANYV NKNGFVRGWNDVAKVPYLYNATTGTFISYDDNESMKYKTDYIKTKGLSGAMFWELSGD CRTSPKYSCSGPKLLDTLVKELLGGPITQKDIEPPTNVKNIAVTNKNSNSVQLNWTAS TDNVGVTEYEITAGEEKWSTTTNSIAIKNLKPNTEYTFSILAKDAAGNKSQPTSIIVK TDGANTTPPGGNSNATFSVTSNWGSGYNFSIVIKNSGTTPIKNWKLEFDYNGNLTQVW DSKISSKINNHYVITNAGWNGEIPPGGSITIGGAGTGTPAELVNASISEN" 705 a 365 c 405 g 550 t BASE COUNT ORIGIN atgagatcaa 61 ctcacaaact 121 attgttgggt 181 gatgcatcaa 241 catggaaatc 301 tctggtgtac 361 tgggctgatg 421 tacgcacgct 481 aaaacaatta 541 gatgaaaaaa 601 tttgacggcg 661 tatcgccctg 721 acgaaagctg 781 caacgttatg 841 attatgacgt 901 tacaaagatc 961 atttatacaa 1021 cgcgggtgga 1081 agcgatggaa 1141 gtgtacgatt 1201 tggaacgatg 1261 tatgatgaca 1321 ggcgcaatgt 1381 ggaccaaaat 1441 gatattgagc 1501 gttcaattaa 1561 gctggagaag 1621 aatacagaat 1681 acttctatta 1741 gctacctttt 1801 aatagtggaa 1861 acacaagttt 1921 gcaggatgga 1981 ggcactcctg aaaaattcac ttattactcc attttccttc agctaactca cttctactca cactgcaaaa tcacaaaatc gcggaaattt tttccgttgg caagaaaagt ttgatttaga aagataaaca gtgcagaaga ctgatcatac atgatttcca caaacgaccc atgaaggggt aaagttgtgg agctcgcttc atggtgattt tggcgaaagt acgaatctat tttgggagct tacttgatac caccaacaaa actggacggc agaaatggag acacattttc ttgtaaaaac cagtcacttc cgacccctat gggattctaa atggtgaaat ctgaacttgt actgctatta caatgtcgta atggggcatt tttaaactat ccctgataat taaagaggtc ttatcctggc cggcgaactg tggctggact attcgctgat ttgggaatat aagcttcacc tggtaaacaa agagctaaag cggtggatgg agcagcggat tccagcagat aaaagaaaat taaaggtact agcagctaat accttattta gaaatataaa tagtggtgac gttagtaaaa cgtaaaaaat atctactgat tacaacaaca aatactagca agatggtgct aaattgggga taaaaactgg aattagtagt tcctcctggt aaatgcatcc 58 ctatccctac ttagcagatt tacggacgta gctttcgctg ccaaataaac cctaatggta tcaggtacaa aaacgattaa tggtctaacc tctacagtcg ccaggcgtag ctactccttc tatttactaa aaaatctctc gaagctactt acgaaatttt aaactcgtat aacggacaat tgggatgact tatgttaata tataatgcaa acagactata tgtcgcacaa gaattactag attgctgtaa aacgtaggag aatagcattg aaagatgctg aacacaacac agtggttaca aaattagaat aaaataaata ggatcaatta attagcgaaa tactcttctt cacaaaagca attatcaagt atatttgctg aaacgtggaa ctctcgtact cttgggaaga aagctaagta gcttttctga atttcctacg aaacgattcc aggatgttcg caattgcatc aaatactgga ctaaccataa acgtagatgg taggtgtacc accaaccttg attctaccgg aaaatggttt ctacaggcac taaagacaaa gtccaaaata gtggacctat caaataaaaa ttacggaata caattaaaaa ctgggaataa ctcctggtgg acttctcgat ttgattataa atcattacgt caatcggagg actaa acctcttttt aggacaaaaa tgcagacatt gaatggaaaa ctgtaaagaa cggtgagcca ttgtgataaa tcctcaccta catggccgct cgaatatgga tggtggtagt aaatgcatta aggtgcaagc ttggattaat tgcagctcta tgcgatagac attttacgga taaaccaggt cgatacaggt tgttcgcgga atttattagc aggtttaagt tagttgtagt tactcaaaaa ttcaaactca tgaaattact cttaaaacct atcacagcct aaatagcaat tgtaattaaa cggcaattta aattacgaat ggcaggaaca Phụ lục Thang phân tử chuẩn 100 bp (Nguồn:https://visitech.vn/product-tag/100bp-dnaladder/) Phụ lục Thang phân tử kb chuẩn (Thermo Scientific, Mỹ) (Nguồn: https://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0013004_GeneRuler_1kb _DNALadder_250ug_UG.pdf) 59 ... Xuất phát từ sở trên, thực đề tài: ? ?Phân lập tạo dịng gen mã hóa chitinase từ vi khuẩn Bacillus sp. ” MỤC TIÊU ĐỀ TÀI Phân lập đƣợc vi khuẩn Bacillus sp có khả sinh tổng hợp chitinase cao tạo dịng... thành cơng gen mã hóa chitinase từ chủng Bacillus sp phân lập Ý NGHĨA CỦA ĐỀ TÀI 3.1 Ý nghĩa khoa học Cung cấp dẫn liệu khoa học quy trình tạo dịng gen mã hóa chitinase từ vi khuẩn Bacillus sp. , góp... ĐỊNH DANH VI KHUẨN BẰNG KỸ THUẬT SINH HỌC PHÂN TỬ 35 3.6 KHUẾCH ĐẠI PCR GEN MÃ HÓA CHITINASE 35 3.7 TẠO DÒNG GEN MÃ HĨA CHITINASE VÀO VECTOR pGEM®-T EASY 37 3.8 TRÌNH TỰ GEN MÃ HÓA CHITINASE