slides from a different presentation file that is located on your computer or on a network share do the following
Hacking from a network: SYN flood and TCP Sequence number prediction attacks
... Numbers and determined there is a pattern • The attacker now knows that if he stimulates A again, A will respond with an ISN 128K higher than the last one with the SYN/ACK This means the attacker has ... timer that is usually set for about a minute When the time limit is exceeded, the memory that holds the state for that connection is released and the queue is decremented by one Once the limit has ... address as the sender, and claim we are some other IP address This is often called spoofing The characteristics of this IP address are that it is valid, routable to, and not active or reachable Many...
- 31
- 491
- 0
Báo cáo y học: " Arterial embolization of an extrapleural hematoma from a dislocated fracture of the lumbar spine: a case report" potx
... EH along with an enlarged retroperitoneal hematoma; (3) a D-shaped opacity was seen in one part of the thoracic hematoma; and (4) after AE, the thoracic hematoma reduced in size and then disappeared ... vessels leads to the formation of a paravertebral hematoma if the parietal pleura is undamaged Spontaneous hemostasis usually occurs in these circumstances A rare case of vertebral fracture presenting ... caused a massive retroperitoneal hematoma and EH The typical radiological finding of EH is a D-shaped opacity with its base against the adjacent part of the chest wall; this is because extrapleural...
- 5
- 199
- 0
Manufacturing location decisions in the pharmaceutical industry an exploratory study from a network perspective
... configuration of a network as the geographic dispersal of factories and the coordination of a network as the linkages between the factories These two characteristics of a manufacturing network ... his theory of transaction cost analysis Williamson (1985), set the basis of the outsourcing theory He established a characterization of transactions with external entities The transactions are ... classified along two dimensions the “vertical integration” and the “horizontal expansion” (Dicken, 1992) Presentation of networks The literature about network organisations is studied here in order...
- 195
- 208
- 0
báo cáo khoa học: " AtKinesin-13A is located on Golgi-associated vesicle and involved in vesicle formation/budding in Arabidopsis root-cap peripheral cells" ppt
... reported that Aminophospholipid ATPase3 (ALA3), a member of the P4ATPase subfamily in Arabidopsis, localizes to the Golgi stacks and that mutations of ALA3 result in devoid of the characteristic ... which the Atkinesin-1 3A and ALA3 play essential roles Conclusion In this paper we found that AtKinesin-1 3A located on Golgi-associated vesicles in Arabidopsis root-cap cells, and the inactivation ... AtKinesin-1 3A antibody and the Arabidopsis seeds of Nag-GFP and kinesin-1 3a- 1 T-DNA line We also thank the Arabidopsis Biological Research Center for services This study was supported by the National Natural...
- 8
- 175
- 0
A STUDY ON SOCIAL NETWORK SITES MARKETING THE CASE OF GOONLINE.VN
... for organizations to increase their brand awareness and facilitate conversations with the customer Additionally, social media serves as a relatively inexpensive platform for organizations to ... understanding their market and spreading the word about their company and the products 20 they offer For many successful organizations, SNS marketing has provided a crucial way to raise that awareness ... the user in the website If there is more information of this type, the operation of CI as accurate, friendly and more reasonable 35 1.7.6 Application Programming Interface (API) API is the way...
- 96
- 567
- 0
Cho bảng số liệu: a) Vẽ biểu đồ thể hiện giá tri sản xuất công nghiệp phân theo thành phần kinh tế của Đông Nam Bộ qua các năm trên. b) Nêu nhận xét.
... năm 2005), cao mức tăng giá trị sản xuất công nghiệp vùng (3,95 lần) + Khu vực có vốn đầu tư nước tăng nhanh gấp 5,0 lần (từ 20.959 tỉ đồng năm 1995 lên 104.826 tỉ đồng năm 2005), cao mức tăng ... tỉ đồng năm 2005), cao mức tăng giá trị sản xuất công nghiệp vùng >>>>> Luyện thi ĐH-THPT Quốc Gia 2016 bám sát cấu trúc Bộ GD&ĐT Thầy Cô uy tín, tiếng đến từ trung tâm Luyện thi ĐH hàng đầu Hà...
- 2
- 1,136
- 2
báo cáo khoa học: "Case of an unusual clinical and radiological presentation of pulmonary metastasis from a costal chondrosarcoma after wide surgical resection: A transbronchial biopsy is recommended" ppt
... low risk [9], and therefore, we chose this approach The transbronchial biopsy revealed pulmonary metastasis from costal chondrosarcoma although the mechanism underlying the pulmonary metastasis ... emrmkt@yahoo.co.jp Department of Orthopedic Surgery, Osaka Medical Center for Cancer and Cardiovascular Diseases, Osaka 537-8511, Japan Full list of author information is available at the end of the ... performed the radiological evaluation; YT: performed the pathological evaluation; NN: assisted in the orthopedic workup of the patient; NA: evaluated critically the manuscript and gave final approval...
- 5
- 464
- 0
báo cáo khoa học: " Analysis of expressed sequence tags from a single wheat cultivar facilitates interpretation of tandem mass spectrometry data and discrimination of gamma gliadin proteins that may play different functional roles in flour" ppt
... residues that are available for disulfide bond formation The considerable heterogeneity observed within the gamma gliadin protein group suggests that it is important to have information about the ... from the N-terminus Seven of 18 ESTs that make up contig #3 and ten of 14 ESTs that make up contig #4 contain the TGC codon for the extra cysteine (Additional File 1) The TGC codon for the extra ... electrophoresis; TaGI: Triticum aestivum Gene Index Acknowledgements The authors thank Drs Ann Blechl and Olin Anderson for critical reading of the manuscript and Stacia Sloane for assistance in data...
- 14
- 325
- 0
How to setup a Linux system that can boot directly from a software RAID
... setup the boot loader: Once the configuration installation options are provides, the installation of the system starts: Notice that while the system is installing, the software RAID transparently ... software RAID partitions to replace the ones of the failed drive The new partitions can be added to the existing raid array with themdadm command: 13 [root@fedora4 giotex]# fdisk -l /dev/hdc Disk ... the disks already contains data, make a backup if needed (all existing data of partitions involved in the process will be lost), and delete or resize existing partitions to create space for the...
- 14
- 567
- 1
Tài liệu Creating an XML File That Shows Changes Made to a DataSet pptx
... Here are descriptions of the three DiffGram sections: The DataInstanceName is the name of the DataSet or DataTable This block contains the current version of the data containing ... both the original and current values for the contents of a DataSet It does not include any schema information The DiffGram is also the primary serialization format used by the NET Framework to ... diffgr:id="Categories2" msdata:rowOrder="2"> 2 Condiments Sweet and savory sauces, relishes, spreads, and seasonings ...
- 6
- 428
- 0
Tài liệu Updating a Data Source with Data from a Different Data Source doc
... contains data and schema information within its contained objects, but not information about the provider that was used to retrieve the data or the original source of the data The DataSet tracks ... the Update( ) method of the destination DataAdapter is called using the DataSet containing the changes as the data object argument; this applies the changes to the destination data source The destination ... changes made to a DataSet and can therefore be used only to keep a second data source synchronized to a data source that is being modified It is called one-way replication The destination data...
- 4
- 326
- 0
Báo cáo khoa học: Molecular characterization of a novel nuclear transglutaminase that is expressed during starfish embryogenesis ppt
... ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG AGAAGAAACAATTACTTCTTAAGTCAATTAATTTTTCTAGAAATGCAAAAGATATTCCCC TTAACAGCTGTTTGAAATGAGGCCTCGGTCTCAAGTTTAAGAGTGCCCCCATATGTAAGC TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG ... A H V T L N V K S A * ATGCGAGGTCAGCATTTATCCAACCAGAAGCTTCACGGAGCTAGCTGGGCAAGGAAATTT GATAATCGCAAGAAATAATTTCCCCCCAAAAACAAAAGGTTGTTGGCTGAAAATACTTCT ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG ... TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG TATTTGGATAAGGTGCATTTGTACATTTTGTGTGTACTGGTTTAGTGTAGAATTTAATTT TTTTTGGTTAATTCTGTCACAAGAACATAATTCTATGGTTACTACACAATGTTGCATCCC AACGCCACCTTTTTATTTTTAATCATATATCATCTCAGTGAAGGTCAGTCCTTG...
- 11
- 501
- 0
Which interest rate scenario is the worst one for a bank? Evidence from a tracking bank approach for German savings and cooperative banks potx
... Volker Wieland Corporate marginal tax rate, tax loss carryforwards and investment functions – empirical analysis using a large German panel data set Fred Ramb 26 22 2007 Volatile multinationals? Evidence ... Bundesbank's banking data see Memmel and Stein (2008) talks with practitioners of the savings banks and cooperative banks sector, we know 11 From that the average duration for savings accounts is assumed ... from the labor demand of German firms Claudia M Buch Alexander Lipponer 23 2007 International investment positions and Michael Binder exchange rate dynamics: a dynamic panel analysis Christian...
- 40
- 468
- 0
Báo cáo khoa học: The Drosophila jumonji gene encodes a JmjC-containing nuclear protein that is required for metamorphosis pot
... were as follows: cycD-F, 5¢-GGGATCCCA CATTGTATTCG-3¢; cycD-R, 5¢-ACGGAGCTTTGAAG CCAGTA-3¢; cycE-F, 5¢-AAGGTGCAGAAGACGCA CTT-3¢; cycE-R, 5¢-AATCACCTGCCAATCCAGAC-3¢; cdk4-F, 5¢-TACAACAGCACCGTGGACAT-3¢; ... regulate chromatin or transcription, as they are generally associated with chromatin- or DNA-binding domains, such as the plant homeodomain (PHD) finger, the TUDOR domain, the ATrich interaction domain ... 2007 The Authors Journal compilation ª 2007 FEBS N Sasai et al catalytically inactive as histone demethylases because of the amino acid changes in the catalytic domain [11,12] Several other JmjC-containing...
- 13
- 356
- 0
Báo cáo khoa học: A designed curved DNA segment that is a remarkable activator of eukaryotic transcription potx
... 5¢-TCAGTTTTTCAGTCAG TTTTTCAGTCAGTTTTTCAGTCAGTTTTTCAC-3¢ and 5¢-GTGAAAAACTGACTGAAAAACTGACTGAAAAAC TGACTGAAAAACTGA-3¢ were annealed to generate a dsDNA fragment, which we named T4-R¢¢ T4-R¢¢ was inserted ... oligonucleotide (T4¢¢), obtained by annealing oligonucleotides 5¢-GTTTTTCATG TTTTTCATGTTTTTCATGTTTTTCAC-3¢ and 5¢-GTG AAAAACATGAAAAACATGAAAAACATGAAAAAC-3¢, Synthetic oligonucleotides 5¢-TCAGTTTTTCAGTCAG ... Designed DNA as an activator of transcription N Sumida et al transient transfection assay system, at a specific rotational phase and distance between T4 and the promoter [12] We concluded that T4 formed...
- 12
- 399
- 0
Báo cáo khoa học: NARG2 encodes a novel nuclear protein with (S/T)PXX motifs that is expressed during development docx
... CATGAG gt gggc … actc ag CTGAGT a 3¢ boundary GAATTG gt gagt … tcac ag GGATAT CAACAG gt aata … ttcc ag ACGTAT TACTTG gt atgt … aatc ag GATATG ACAGAG gt aaaa … tctc ag AAAATT GCATTG gt aagg … attt ... GTGGAC gt atgt … tcca ag ATGCCC AAGGAC gt aagt … ttca ag GATTGC AGAAGA gt aagt … ttgc ag CAATTT ATGTTG gt gagt … tttt ag GGCATA ACTCAA gt aagg … taat ag GATTTC ATGTAG gt aagt … atgc ag CTTGCA GCAAAG ... attt ag GGCAGT CATTAT gt aagt … tttc ag GATATT TTGCAG gt ttgt … ttta ag GTTCAA ATGGAC gt atgt … cata ag ATGTCC AAGGAC gt aagt … ttaa ag GATTGC AGAAGA gt aagt … ttgc ag CAATTT ATGTTG gt aagt …...
- 9
- 470
- 0
Báo cáo khoa học: A distinct sequence in the adenine nucleotide translocase from Artemia franciscana embryos is associated with insensitivity to bongkrekate and atypical effects of adenine nucleotides on Ca2+ uptake and sequestration pdf
... discussions, and U Zsuzsa and A Jakab for excellent technical assistance ´ This work was supported by grants from the Orszagos ´ ´ Tudomanyos Kutatasi Alapprogram (OTKA), Magyar ´ ´ ´ Tudomanyos Akademia ... designated areas (a, b, and c) The part of bovine ANT that is different from Artemia ANT is colored yellow, and the corresponding part of Artemia ANT is colored 830 magenta In region a, this corresponds ... of ANT From these experiments, we concluded that the ANT of our mitochondrial preparations of A franciscana embryos is fully functional ANT of A franciscana is refractory to inhibition by BKA As...
- 15
- 505
- 0
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf
... QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN R3E 119 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGS ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLF RAT R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF HUMAN R3E 178 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLF ... gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 I H F I * 279 921 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig (A) Diagram of human PPP1R3E mRNA compared with PPP1R3E...
- 12
- 381
- 0
Báo cáo khoa học: Activated transglutaminase from Streptomyces mobaraensis is processed by a tripeptidyl aminopeptidase in the final step pptx
... Gly-Arg-pNA Ala-Ala-Pro-pNA Ala-Phe-Pro-pNA Ala-Ala-Ala-pNA Pro-Leu-Gly-pNA Ala-Ala-Phe-pNA Suc-Ala-Ala-Phe-pNA Val-Leu-Lys-pNA Cbz-Pro-Phe-Arg-pNA Ala-Ala-Val-Ala-pNA Ala-Ala-Pro-Leu-pNA Suc-Ala-Ala-Pro-Phe-pNA ... Pro-Leu-Gly-pNA or Ala-AlaPhe-pNA for SM-TAP corresponded to that of Ala-AlaVal-Ala-pNA or Ala-Pro-pNA, exhibiting precisely the sequence of FRAP-TGase Yellowing of the Ala-Ala-Val-Ala-pNA solution must ... aminopeptidase is therefore logical However, a side reaction with the tetrapeptide Ala-Ala-Val-Ala-pNA was revealed The inability of the peptidase to hydrolyse Ala-Ala-pNA and Ala-pNA (or other chromogenic...
- 7
- 480
- 0
Báo cáo Y học: A nonphosphorylated 14-3-3 binding motif on exoenzyme S that is functional in vivo pot
... result of particular subcellular localizations or transcriptional regulation of isoforms rather than of differences in their ability to bind to a specific target From our analysis we have strong evidence ... 14-3-3 antisera specific for the seven isoforms (b, f, s, r, e, g and c) using a BiometraTM slot blot apparatus A summary of these antisera is shown in Table and [41] (A) Whole HeLa cell lysate HeLa ... ExoS ADP-ribosylation activity We show that the ExoS proteins interact with all isoforms of the 14-3-3 family Finally, we show that the DALDL sequence is necessary for the ADP-ribosylation activity...
- 9
- 394
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose