kiaa0725p a novel pla 1 with sequence homology to a mammalian sec23p interacting protein p125
Báo cáo khoa học: Swollenin, a Trichoderma reesei protein with sequence similarity to the plant expansins, exhibits disruption activity on cellulosic materials pptx
... 4204 M Saloheimo et al (Eur J Biochem 269) ExAspBgl2: 5¢-CATTAGATCTCAGCAATGGCTGGT AAGCTTATCCTC-3¢ Primer ExAspXba1: 5¢-CGACTCTAGAAGGATTAGTTCTGGCTAAAC TGCACACC-3¢ The DNA sequence of the amplified ... pGAPT-PG vector consists of pUC18 containing the A nidulans pyrG gene as selectable marker and a 1. 1 kb fragment of the A niger var awamori glaA promoter and a 0.2 kb fragment of an A niger glaA ... Corporation, Canton, MA, USA) clamps spaced 4.5 cm apart A 250 lb load cell was used Test speed was 0 .1 cmÆmin )1, and the peak load was measured before breaking; it typically only took a minute to...
- 10
- 402
- 0
Báo cáo khoa học: Binding of the volatile general anesthetics halothane and isoflurane to a mammalian b-barrel protein doc
... given in Table Halothane displaces 1- aminoanthracene (AMA) bound to the internal cavity in the hydrophobic core of porcine odorant binding protein Figure shows that halothane can displace AMA from ... thermodynamically using isothermal titration calorimetry [12 ] The ability of halothane to displace the fluorescent probe 1- aminoanthracene (AMA) bound in the porcine odorant binding protein cavity was ... indicate that halothane is able to displace the bound AMA with a Kd of 0.43 ± 0 .12 mm This value is quite comparable to the Kd of 0.46 ± 0 .10 mm determined for the binding of halothane to the protein, ...
- 9
- 421
- 0
Báo cáo khoa học: Interactions of HIPPI, a molecular partner of Huntingtin interacting protein HIP1, with the specific motif present at the putative promoter sequence of the caspase-1, caspase-8 and caspase-10 genes pdf
... Allowing one substitution Allowing two substitutions Allowing two substitutions Allowing one substitution AAAGACATG AAAGACAGG AAAGAGATT AAAGAGATG AAAGACATA AAAGACATA AAAGAGAAC AAAGACATA AAAGAAAAG ... AAAGAAAAG AAACAGATG AAAGAAAAG AAAGAAAAG GAAGACATT ENSG00000003400 Caspase -10 10 1 675 814 8 01 355 315 963 808 418 262 6 51 725 857 caspase -10 gene, four variant motifs were identified Among them, AAACAGATG ... putative HIPPI-binding motif and its mutants ND, not determined Fluorescence quenching Sequence EMSA Result Average Kd (nM) AAAGACATG AGAGACATG AAGGACATG AAATACATG AAAGCCATG AAAGAGATG AAAGACCTG...
- 14
- 393
- 0
Báo cáo y học: " Vgf is a novel biomarker associated with muscle weakness in amyotrophic lateral sclerosis (ALS), with a potential role in disease pathogenesis"
... the ALS phenotype 98 10 11 12 13 14 Acknowledgements Supported by ALS grant from the Department of Veterans Affairs, NCCAM 5R 21 AT002602-02 and NCCAM 1R 21 AT003632-0 1A1 to GMP and NARSAD and ... 2004; 10 1(30): 11 159 -11 164 Garcia AL, Han SK, Janssen WG, Khaing ZZ, Ito T, Glucksman MJ, Benson DL, Salton SR (2005) A prohormone convertase cleavage site within a predicted alpha-helix mediates ... Shimbara T, Kageyama H, Mondal MS, Toshinai K, Date Y, Gonzalez LJ, Shioda S, Takao T, Nakazato M, Minamino N Peptidomic identification and biological validation of neuroendocrine regulatory...
- 8
- 499
- 0
Tài liệu Báo cáo khoa học: A peptide containing a novel FPGN CD40-binding sequence enhances adenoviral infection of murine and human dendritic cells doc
... NIH awards K08 AI 015 86 and R 21 AI46 312 This work was also supported by Department of Defense (DOD) grants to S D (DAMD17-99 -1- 93 61, DAMD17- 01- 1-0384 and DAMD1-99 -19 3 61) The US Army Medical Research ... there was no detectable endotoxin in the final preparation as assessed by E-Toxate assay (Sigma) A PhD -12 phage library was prepared and expanded according to manufacturer’s directions (New England ... A. , Al-Ghonaium, A. , Soresina, A. R., Loubser, M., Avanzini, M .A. , Marconi, M., Badolato, R., Ugazio, A. G., Levy, Y., Catalan, N., Durandy, A. , Tbakhi, A. , Notarangelo, L.D & Plebani, A (20 01) ...
- 8
- 458
- 0
Báo cáo khoa học: Existence of novel b-1,2 linkage-containing side chain in the mannan of Candida lusitaniae, antigenically related to Candida albicans serotype A potx
... Manb1fi2Mana1fiphosphate Manb1fi2Manb1fi2Mana1fiphosphate a1 fi2Mana1fi3Mana1fi2 a1 fi3Mana1fi2Mana1fi3Mana1fi2 ›6 ›6 Mana1 Mana1 Mana1fi2Mana1fi2 a1 fi2Mana1fi2Mana1fi2 b1fi2Mana1fi2Mana1fi2 a1 fi3Mana1fi2Mana1fi2Mana1fi2 ›6 Mana1 ... Mana1 Mana1fi3 a1 fi6Mana1fi6Mana1fi6Mana1fi6 ›2 Mana1 a1 fi6Mana1fi6Mana1fi6Mana1fi6 > > ›2 ›2 ›2 > > = Mana1 a1 fi6Mana1fi6Mana1fi6Mana1fi6 > ›2 > > > a1 fi2Mana1 ; a1 fi6Mana1fi6Mana1fi6Mana1fi6 ›2 ›2 ›2 a1 fi2Mana1 ... Mana1fi2 Mana1fi6 a1 fi6Mana1fi6 a1 fi3Mana1fi2 Manb1fi2Mana1fi3 Manb1fi2Manb1fi2Mana1fi3 Manb1fi2Mana1fi2 Manb1fi2Manb1fi2Mana1fi2 Manb1fi2Manb1fi2Manb1fi2Mana1fi2 Manb1fi2Manb1fi2Manb1fi2Mana1fi2 Manb1fi2Manb1fi2Manb1fi2Mana1fi2...
- 11
- 456
- 0
Báo cáo khoa học: Biosynthesis of D-arabinose in mycobacteria – a novel bacterial pathway with implications for antimycobacterial therapy pdf
... terminal Ara6 motifs: Arafb1 fi 2Arafa1 fi 5(Arafb1 fi 2Arafa1 fi 3)Arafa1 fi 5Arafa1 About two-thirds of the terminal b-Araf and the penultimate 2 -a- Araf serve as attachment sites for mycolic acids ... the Ara6 motif similar to that present in arabinogalactan, and a simplified linear Ara4 motif: Arafb fi 2Arafa1 fi 5Arafa1 fi 5Arafa1 Some of the non-reducing arabinofuranose termini are capped with ... [26] The branched arabinan chains of the arabinogalactan are attached to the linear galactan backbone The arabinan consists of an inner linear region of Araf- (1 fi 5) -a- Araf and of branched non-reducing...
- 21
- 572
- 0
Báo cáo khoa học: Characterization of novel sequence motifs within N- and C-terminal extensions of p26, a small heat shock protein from Artemia franciscana potx
... N-terminal extension G 5¢-GGCACTTAACCCATGGTACATGGACCTTGATATTGAC-3¢ 5¢-GTCAATATCAAGGTCCATGTACCATGGGTTAAGTGCC-3¢ 5¢-GGACCTTGATATTGACGGTCCAGATACC-3¢ 5¢-GGTATCTGGACCGTCAATATCAAGGTCC-3¢ 5¢-GGATTGAAGGGGGAAGATCAGGAGGTGC-3¢ ... amino acid sequences of selected sHSPs were analyzed by CLUSTAL W (1. 82) Ap26, A franciscana p26, AAB87967; HCRYAA, Homo sapiens aA-crystallin, P04289; HCRYAB, H sapiens aB-crystallin, P02 511 ; ... by a Natural Sciences and Engineering Research Council of Canada Discovery Grant, a Nova Scotia Health Research Foundation ⁄ Canadian Institutes of Health Regional Partnership Plan Grant, and a...
- 14
- 358
- 0
báo cáo hóa học: " Boosting with intranasal dendrimeric Aβ1–15 but not Aβ1–15 peptide leads to an effective immune response following a single injection of Aβ1–40/42 in APP-tg mice" ppt
... mapping; A 1 15 , A 1 7, A 3–9, A 6– 20, A 11 –25, A 26–42, and A 1 40 Diluted plasma samples were co-incubated with peptide fragments overnight and applied to A 1 40-coated ELISA plates Immunohistochemistry ... LT(R192G) A 40/42 A 1 15 dA 1 15 8 .1 ± 1. 8 6.0 ± 1. 8 9.4 ± 1. 6 5.8 ± 1. 9 12 .3 ± 1. 1 10 .1 ± 3.0 13 .3 ± 1. 9 7.8 ± 2.5 485.8 ± 12 3.0 17 8 .1 ± 49.8 3 31. 7 ± 71. 2 224 .1 ± 58.9 2 017 .5 ± 659 .1 757.6 ± 18 6.7 ... the A 1 7 region Anti -A Anti -A antibodies recognize an epitope within the A 1 7 region Absorption of diluted plasma from J20 APPtg mice producing anti -A antibodies with A 1 7, A 1 15 or A 1 40...
- 10
- 398
- 0
Báo cáo toán học: "The Structure of Maximum Subsets of {1, . . . , n} with No Solutions to a + b = kc" potx
... ∩ A is nearly empty Comparing A2 with A1 will then reveal that most of (l2 , r2 ] is contained in A Again Lemma will help us to see that A cannot share many elements with (r2 , l1 ] and a final ... into a set At of intervals as in (1) Our plan is to show that each member of the transformation sequence (Ai ) is k-sum-free and has size greater than or equal to |A| For n sufficiently large, ... [l1 − ξ2 − 2k + 1, l1 ] ∩ A If sB < l1 with C as in (I) we can verify that, for sufficiently large n, C⊆ 2r1 − 1 − kξ2 − 2k + k − , r1 ⊆ (l1 , r1 ], |C \ A| > |B| and max K < sC By analogy with...
- 16
- 268
- 0
Báo cáo y học: " A novel trifunctional IgG-like bispecific antibody to inhibit HIV-1 infection and enhance lysis of HIV by targeting activation of complement" ppsx
... of two parts N Engl J Med 20 01, 344 :11 40 -11 44 Jia et al Virology Journal 2 010 , 7 :14 2 http://www.virologyj.com/content/7 /1/ 142 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Walport MJ: ... protection against HIV Nature 2007, 449 :10 1 -10 4 Page of 28 Willey S, Aasa-Chapman MM: Humoral immunity to HIV -1: neutralisation and antibody effector functions Trends Microbiol 2008, 16 :596-604 doi: 10 .11 86 /17 43-422X-7 -14 2 ... HIV -1 AIDS 19 96, 10 :16 11- 1620 Saifuddin M, Parker CJ, Peeples ME, Gorny MK, Zolla-Pazner S, Ghassemi M, Rooney IA, Atkinson JP, Spear GT: Role of virion-associated glycosylphosphatidylinositol-linked...
- 4
- 242
- 0
Báo cáo khoa học: " Evidence for a novel gene associated with human influenza A viruses" pptx
... Lowen AC, Pena L, Angel M, Solorzano A, Albrecht R, Perez DR, Garcia-Sastre A, Palese P: Live attenuated influenza viruses containing NS1 truncations as vaccine candidates against H5N1 highly pathogenic ... 89:2359-2376 Gambotto A, Barratt-Boyes SM, de Jong MD, Neumann G, Kawaoka Y: Human infection with highly pathogenic H5N1 influenza virus Lancet 2008, 3 71: 1464 -14 75 Ghedin E, Sengamalay NA, Shumway M, Zaborsky ... viruses that contained a 216 codon NEG8 ORF also had the same change as the human viruses and were serotypes H1N1, isolated in 2007 (China, Accession No FJ 415 613 ; A/ swine/Zhejiang /1/ 2007(H1N1)), and...
- 12
- 253
- 0
Báo cáo khoa học: " Development of a novel monoclonal antibody with reactivity to a wide range of Venezuelan equine encephalitis virus strains" docx
... ( 1A4 A -1, 3B 2A- 9 and 1A3 B-7) Humanisation of CUF37- 2a will be essential if this antibody is to find use as an antiviral in humans and these data suggest that CUF37- 2a may be a suitable candidate ... Virology Journal 2009, 6:206 10 11 12 13 14 15 16 17 18 19 20 21 Casamassima AC, Hess LW, Marty A: TC-83 Venezuelan equine encephalitis vaccine exposure during pregnancy Teratology 19 87, 36:287-289 ... into a murine IgG 2a kappa antibody, which was designated CUF37- 2a Murine IgG 2a was chosen as the framework as it has equivalent biological and functional activities to human IgG1 The amino acid...
- 9
- 290
- 0
Retrovirology Research BioMed Central Open Access A novel HIV-1 restriction factor that is potx
... 0 .1 0 .1 10 12 14 16 10 12 14 16 10 12 14 16 10 00 10 000 10 000 10 000 clone #6 clone #7 A3 H mRNA clone #8 10 0 10 00 10 00 10 00 10 0 10 0 10 0 10 10 10 10 1 1 0 .1 0 .1 0 .1 10 12 14 16 0 .1 10 12 14 16 10 ... CEM-T4 10 10 10 10 10 0 10 10 clone #6 #8 10 0 10 0 CEM.NKR 10 00 10 10 10 clone #7 10 10 10 10 clone #8 10 #5 #7 10 #4 #1 10 10 10 #6 #3 #2 10 10 10 10 10 10 0 10 10 10 10 0 10 10 10 10 10 10 10 10 ... 10 00 10 10 0 CEM.NKR 10 10 10 10 10 10 10 10 10 0 10 10 10 10 0 10 10 10 10 10 10 10 10 clone #3 10 clone #4 10 clone #5 10 0 .1 10 12 14 16 Days postinfection 10 10 B 10 10 000 10 10 10 10 10 CEM-T4...
- 12
- 279
- 0
Báo cáo y học: "Sequence homology: A poor predictive value for profilins cross-reactivity" ppt
... Watermelon (AAU43733 .1) Tomato (CAD10377 .1) Bermuda grass (CAA69670 .1) Banana (AAK54834 .1) Latex (CAD37202 .1) Peach (CAB 519 14 .1) 80 90 10 0 11 0 12 0 13 0 | | | | | | | | | | | | KYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVERLGDYLIDQGL ... citation purposes) Clinical and Molecular Allergy 2005, 3 :13 http://www.biomedcentral.com /14 76-79 61/ 3 /13 Cuc m (AAP13533.2) Watermelon (AAU43733 .1) Tomato (CAD10377 .1) Bermuda grass (CAA69670 .1) ... RC, OAS, SI RC, OAS, SI, G RC, OAS, SI, C R, OAS RC, OAS, SI, C R, OAS, C, D RC, OAS, U, SI RC, OAS, SI, C, E R, OAS OAS R, OAS Grape, Kiwi Grape Tomato Grape Kiwi,Tomato Tomato, grape, peach,...
- 9
- 211
- 0
TARGETING ACUTE PHOSPHATASE PTEN INHIBITION AND INVESTIGATION OF A NOVEL COMBINATION TREATMENT WITH SCHWANN CELL TRANSPLANTATION TO PROMOTE SPINAL CORD INJURY REPAIR IN RATS
... PI3K/Akt/mTOR pathway signaling and related inhibitors PI3K/Akt/mTOR, autophagy, and apoptosis inhibitors PI3K inhibitors include LY294002 and also wortmannin (Arcaro and Wymann, 19 93, Vlahos et al., ... century with the work of Ramon y Cajal (Ramon y Cajal, 19 28), and reinvigorated several decades later (David and Aguayo, 19 81, Bray et al., 19 87), showed that spinal axons regenerated into grafted ... normal degradation and causing accumulation of waste-filled autophagosomes, promotes autophagy-induced neurodegeneration in contrast to an upregulation of autophagy and autophagosome production As...
- 181
- 235
- 0
SYNTHESIS, STRUCTURE AND CATALYTIC APPLICATION OF NOVEL CARBENE COMPLEXES WITH BENZOTHIAZOLIN 2 YLIDENE LIGANDS 1
... the angiotension II antagonist, 212 the platelet activating factors antagonist 213 and the SRS -A antagonists (slow-reacting substances of anaphylaxis). 214 28 Synthesis, Structure and Catalytic Application ... [Pd(allyl)Cl] ,12 5 -12 6 PdCl (CH CN) , 83-84 ,11 7 -12 4 Pd(cod)CH Cl, 41, 118 -11 9 ,12 7 -12 8 PdCl (PhCN) ,95 ,11 9 Pd(cod)Cl , 41, 118 ,11 9 ,12 8 -13 0 Pd(cod)Br , 41 Pd(cod)CH Br. 41 Ag(I)-NNHC complexes can be prepared ... Ir(I),96 ,10 0 ,10 2 Ru(II) ,10 3 -10 8 Ru(III) ,10 6 Cu(I), 85 ,10 8 -11 3 Cu(II) ,10 8 ,10 9 ,11 1 ,11 3 have been prepared This method is particularly useful for preparing carbene complexes with NNHC ligands bearing base-sensitive...
- 32
- 385
- 0
A methodology for validation of integrated systems models with an application to coastal-zone management in south-west sulawesi
... of fish blasts, the total capacity of urban wastewater treatment plants, and the total capacity of treatment plants for industrial wastewater Examples of empirical parameters in RaMCo are the price ... which aims at identifying, analyzing and evaluating management strategies, is that of policy analysis 22 Chapter1 Policy analysis and rapid assessment models According to Miser and Quade (19 85), ... variables No data Rational validation Stimuli MODEL SYSTEM Objective variables Available data Empirical validation Stimuli REAL SYSTEM Objective variables Figure 2 .1 Conceptual framework of analysis...
- 139
- 492
- 0
ĐỀ THI THỬ ĐẠI HỌC LẦN 1 NĂM HỌC: 20122013 Tổ: Toán – Tin học MÔN: TOÁN (Khối A+A1+B+D)
... ngtrũnngoitiptamgiỏcABC,tcltrungimIcaBC. TatớnhcBC= 2a, ttamgiỏcDBCvuụngcõntiDnờnchiu caoDI =1/ 2BC =a. Khiú: 1 a3 a VDABC = DI S ABC = a. a .a = ị VDEBC = (dvtt ) 6 18 TrongmtphngtoOxychotamgiỏcABCc A( 13 )B(ư 11 )C(30).Lpphngtrỡnh ... 0,25 E A C I B V DE = ị VDEBC = V Tacú: DEBC = DABC VDABC DA *)TớnhVABCD 0,25 www.VNMATH.com 6a 7a 8a 1im 1im 1im DoDA=DB=BCnờnhỡnhchiucaDlờn(ABC)chớnhltõm ngtrũnngoitiptamgiỏcABC,tcltrungimIcaBC. ... k = (x +1) -m im 0,25 0,25 0,25 0,25 0,25 0,25 Suyra: k + k1 = M: 1- m 1- m 1 - m + = + (do > 0) 1- m 1- m -m 1- m + 1- m Du=xyra: Cauchy 0,25 1 - m = 1, "m 1 -m 1 - m ộ m = -1 = 1- m ởm =...
- 6
- 631
- 9
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008