in a datagram network each packet is independent the routing of a packet is done for each individual packet each packet t
Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx
... media is to be installed – The amount of data and the speed at which it must be transmitted – The cost of the media and installation 17 Local Area Network (LAN) Local Area Network (LAN) An individual ... running on the intermediary network devices perform these functions: – Regenerate and retransmit data signals – Maintain information about what pathways exist through the network and internetwork ... protocol suite The terms are often used interchangeably Strictly speaking, the suite is the definition of the protocols, and the stack is the software implementation of them 24 Network Protocols...
- 52
- 550
- 0
A STUDY ON THE USE OF CLASSROOM DISCIPLINE AS MOTIVATION FOR SECOND LANGUAGE ACQUISITION IN THE CONTEXT OF ENGLISH LANGUAGE TEAC
... dialect of the native language spoken by the students (i.e., whether it is standard or nonstandard), the relative status of the students' language in the community, and societal attitudes toward the ... the authority of the teacher Rather, focus is placed mainly on the learning process The term ‘motivation’ fits in this context nicely It is unfortunate that, however, that the practice of using ... the teacher as an informant, a facilitator, a monitor, an assessor, an organizer, a controller, a manager, who acts interchangeably within the classroom hours Another categorization of the teaching...
- 41
- 886
- 12
Báo cáo khoa học: "Separable Verbs in a Reusable Morphological Dictionary for German" pdf
... separable verbs in WM The dots in the last line mark the absence of a line break in the actual code Feature specifications separated by tabs refer to sets of formatives in paradigmatic variation ... specification departs from the usual specification of a target in a WFRule in two respects First, instead of concatenating the source formatives, the rule lists them, leaving concatenation to the ... places in the string where other material may intervene, because this information is available in the relevant PIClass of the database (6) daniel versuchen zu aufh6ren The task of the client application...
- 5
- 380
- 0
báo cáo hóa học:" Estimating the cost of care giving on caregivers for people living with HIV and AIDS in Botswana: a cross-sectional study" doc
... by trained research assistants before questionnaire administration The caregivers were informed that participation in the study was voluntary, that there was no payment for participation, and that ... reluctant to participate in the study and because some of them were not available after several visits by the research assistants within the period of the survey This response percentage is reasonably ... that they were free to withdraw from participating at any time They were assured of the confidentiality of the information obtained as the questionnaire was coded to ensure anonymity Each caregiver...
- 8
- 384
- 0
báo cáo hóa học:" A promising method for identifying cross-cultural differences in patient perspective: the use of Internet-based focus groups for content validation of new Patient Reported Outcome assessments" potx
... 103:566-569 Stoop AP, Berg M: Integrating quantitative and qualitative methods in patient care information system evaluation: guidance for the organizational decision maker Methods of Information in Medicine ... measurement and operational activities associated with the hypothetical deductive approaches of positivistic science [58] When qualitative and quantitative activities meet The apparent duality ... engagement, facilitation and surveying; and 3) the automated management of resulting transcripts and survey data [4] Demonstration that virtual methods provide equivalent qualitative results as both traditional...
- 14
- 441
- 0
Báo cáo y học: "Efficacy of customised foot orthoses in the treatment of Achilles tendinopathy: study protocol for a randomised trial" pps
... Zammit GV, Landorf KB, Handley CJ, Elzarka A, Deluca J: Efficacy of intra-articular hyaluronan (Synvisc) for the treatment of osteoarthritis affecting the first metatarsophalangeal joint of the ... assess the clinical severity of Achilles tendinopathy [29] The VISA -A questionnaire evaluates three domains that are clinically relevant to patients: pain, function and activity The VISA -A questionnaire ... at any time during the study The researchers involved in the data entry phases of this study will be blinded as to the intervention the participants have been allocated to Participant compliance...
- 13
- 443
- 0
Báo cáo y học: "Role of vasopressin in the treatment of anaphylactic shock in a child undergoing surgery for congenital heart disease: a case report" docx
... [12], the above described pharmacological rationale and the choice of avoiding escalating therapy with alpha agonists This pharmacological approach allowed us to titrate the drug to the minimum ... reporting vasopressin administration to treat anaphylactic shock [12] To our knowledge this is the first case report documenting the evidence of efficacy of vasopressin administration in anaphylactic ... endothelium cells activates both the nitric oxide (NO) and the prostacycline mediated vasodilating pathways [5] Activation of inducible NO synthase (iNOS) is a major contributor to both vasodilatation...
- 4
- 370
- 0
Báo cáo y học: " Short distance movement of genomic negative strands in a host and nonhost for Sugarcane mosaic virus (SCMV)" docx
... was to make an initial attempt to characterize nonhost and host specific resistances to the Mexican isolate, SCMV-VER1, at the early stages of the virus replication This was done comparing two ... or that the RNA is a remnant of the virus inoculum To investigate this, the inoculated leaf was divided in four sectors using the inoculation zone as a reference: two sectors in each the apical ... on the involvement of proteins on the local and systemic Page of translocation of the negative viral strand and even fewer dealing with its plant protein interactions [18] The aim of this study...
- 8
- 279
- 0
Báo cáo y học: " Sinusoidal obstruction syndrome (veno-occlusive disease) in a patient receiving bevacizumab for metastatic colorectal cancer: a case report" pptx
... involved in the care of the patient All authors have been involved in drafting or critically revising the manuscript for intellectual content and they have read and approved the final version submitted ... Consent Written informed consent was obtained from the patient for the publication of this case report and accompanying images A copy of the written consent is available for review by the Editor -in- Chief ... evidence of malignant cells Upper gastrointestinal endoscopy showed oesophageal varices, a Barrett's oesophagus and portal gastropathy These findings were all consistent with an intrahepatic cause of...
- 4
- 479
- 0
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt
... YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT YYEGVAVLGTYSNHTSAPANCSVTSQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLASPAGTIWACSTGLT YYEGVAVLGTYSNHTSAPANCSAASQHKLTLSEVTGRGLCIGTVPKTHQALCNTTLKTGKGSYYLVAPAGTMWACNTGLT ... than that to AAUA- or hXpr1-expressing cells These results indicate that the 1E Env can bind most efficiently to a receptor containing the fourth ECL (AAAU), but equal binding of 1E Env to AAUA ... consistent with the ability of the AAAU chimera to mediate entry of vectors bearing the AKR6 Env Interestingly, AKR6 virus binding to cells expressing the AAUA chimera was much higher than that of...
- 12
- 227
- 0
Báo cáo y học: "Mediators of physical activity change in a behavioral modification program for type 2 diabetes patients" docx
... in the interpretation of the data and helped to draft the manuscript, revised the manuscript for important intellectual content and supervised KDG as part of their PhD training DVD, JR, CTL and ... were mainly related to increases in steps and active transport, which means that the intervention succeeded in changing the perceptions of partners of the patients and in attempts to encourage them ... participants if they thought they were able to make an inventory of future high-risk situations that can contribute to relapse episodes and cope with these situations Statistical analysis Data were analyzed...
- 13
- 276
- 0
A study on using authentic materials in teaching English in the context of Bac Giang High school for gifted students = Nghiên cứu việc sử dụng tài liệu xác thực
... of teachers shared the opinion that they often used authentic materials in the classroom They reasoned that using authentic materials to teach English brought their students close to the target ... Finally, authentic materials are available everywhere A vast amount of materials can be accessed on the Internet Teachers can take these materials to the class, integrate the technology into the class, ... background This may discourage both teachers and learners from using authentic materials in language teaching and learning The third problem is that obtaining and adapting authentic materials can be timeconsuming...
- 57
- 2,340
- 7
Carbonation of Mg(OH)2 in a pressurised fluidised bed for CO2 sequestration
... extraction in waste streams than natural minerals, but the prospect of utilising an otherwise worthless industrial side-stream is also a strong driving force The realisation that industrial waste ... properties of waste materials, care should be taken to ensure that this actually is the case Another aspect that also requires additional attention is the industrial-scale feasibility of the processes ... stated that the removal of heat shifts the equilibrium further to the right, again favouring carbonation In other words, adding heat (increasing the temperature and reaction rate) to the system favours...
- 71
- 454
- 0
Evaluation of the Effects and the Programming of ‘Water Conservation Plan’ (WCP) for Total Water Resources Management in Tokyo
... Japan Statistical Yearbook 2005, Statistics Bureau, Ministry of Internal Affairs and Communications, Tokyo, Japan Statistics Bureau, Ministry of Internal Affairs and Communication (2007) National ... instance, it took up to years to reach agreements between the socialist and capitalist party to introduce the cumulative charging system Intermediary Scheme Rainwater harvesting is considered as ... system since there were controversial issues between political parties during the time regarding the charging system The debate for the adequacy of such system was between the capitalist party and...
- 19
- 593
- 0
Báo cáo khoa học: Role of Ca2+/calmodulin regulated signaling pathways in chemoattractant induced neutrophil effector functions Comparison with the role of phosphotidylinositol-3 kinase ppt
... CaMKII forward: 5¢-GGTTCACGGACGAGT ATC-3¢, reverse: 5¢-TGGCATCAGCTTCACTGTA-3¢; CaMKIV forward: 5¢-GATGAAAGAGGCGATCAG-3¢, reverse: 5¢-TAGGCCCTCCTCTAGTTC-3¢; CKLiK forward: 5¢-GGCAAAGGAGATGTGATG-3¢, ... sufficient to activate these kinases and suggests that the elevated [Ca2+]i generated by chemoattractants might be important in activation of downstream signaling events Compared to fMLP treatment, ... chemoattractants has been reported to result in the activation of several intracellular signaling pathways It is of were interest to determine whether changes in [Ca2+]i alone could modulate these...
- 10
- 537
- 0
Guidance on the teaching of writing skills INSET opportunities for teachers of a subjects across the curriculum at Key Stages 2 and 3 docx
... document suggests, therefore, that attention needs to be paid to the explicit teaching of individual skills in a systematic way, and at the time(s) most appropriate for the individual learner Teaching ... elements is important in the production of a finished piece of writing There is, however, a danger that the teaching of writing can easily be reduced to teaching by correction – teaching after the ... in this document aim to outline the various stages in the teaching of writing that a teacher needs to consider No-one would advocate giving a learner an empty sheet of paper and a title and telling...
- 174
- 616
- 0
Doctor of Philosophy in Mathematics Linear and Non-linear Operators, and The Distribution of Zeros of Entire Functions
... summands and of the sum are all equal, then 21 the type of the sum is not greater than the larger of the types of the two summands In addition, if one of the two functions is of larger growth than the ... treatise on the subject [65], mathematicians turned o their attention to increasingly greater abstraction Perhaps as a secondary effect of the computer revolution and the heightened activity in approximation ... is a similar result due to Gauss, that gives the locations of the critical points, although beautiful and relevant in its statement, it is not an exact analogue of Rolle’s theorem Theorem (Gauss-Lucas...
- 104
- 494
- 0
Báo cáo khoa học: Alternative initiation of transcription of the humanpresenilin 1gene in SH-SY5Y and SK-N-SH cells The role of Ets factors in the regulation ofpresenilin 1 pptx
... Ets GGAA fi TTAA mutation The activity of PS1CAT constructs including the promoter fragments shown on the left containing (m) or not (wt) the GGAA to TTAA mutation at the )10 Ets site was assayed ... by substituting mutant templates instead of wild type The probe containing a mutation at +165 was generated by substituting p27m (5¢-gat ctctagaCGGTGCCTGACTGGCTTGC-3¢) p27 instead of Results Differential ... factors have been known to activate transcription and to form synergistic interaction with Ets factors binding at adjacent sites [31] The specific factors that transactivate PS1 through binding at the...
- 10
- 492
- 0
THE ATTRACTIONS OF RISK-BASED REGULATION: ACCOUNTING FOR THE EMERGENCE OF RISK IDEAS IN REGULATION docx
... move to a ‘cost benefit analysis culture’ that is a move away from informal qualitatively based standard setting towards a more calculative and formalised approach Integrated and more holistic approaches ... operating and maintaining a sound system of control in business financial management, in particular it supports a top- down, integrated corporate risk management policy The ideal is that risk is analysed, ... 1996; Toft, 1996) The interpretation of the data may prove difficult in a variety of ways For example, the causes of a risk may not be clear and even where they are clear the decision about what is...
- 21
- 533
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008