ghosh functional coatings wiley vch verlag gmbh amp co kgaa weinheim 2006 isbn 3 527 31296 x
Wiley - VCH Dieter Stoye, Werner Freitag Editors Paints, Coatings and Solvents potx
... 2.14 .3 2.14.4 2.15 2.1 5.1 2.15.2 3. 1 3. 1.1 3. 1.2 3. 1 .3 3.2 3. 2.1 3. 2.2 3. 3 3. 3.1 3. 3.2 3. 3 .3 3.4 3. 4.1 3. 4.2 3. 4 .3 3.4.4 3. 4.5 3. 4.6 3. 4.7 3. 5 3. 6 3. 7 3. 7.1 3. 7.2 3. 7 .3 3.7.4 3. 8 4.1 4.2 4 .3 4 .3. 1 ... 35 3 35 8 15 References 37 5 32 4 32 5 32 5 32 6 Index 36 6 36 8 37 2 401 Paints, Coatings and Solvents Second, CompletelyRevised ... Pigments Second, Completely Revised Edition 1997 ISBN: 3- 527- 28 836 -8 Automotive Paints and Coatings Edited by Gordon Fettis First Edition 1995 ISBN: 3- 527- 28 637 -3 Hans G Volz Industrial Color Testing...
- 423
- 622
- 1
ansorge r. mathematical models of fluid dynamics (wiley-vch,2003)
... Fluiddynamics Rainer Ansorge Copyright c 20 03 Wiley- VCH Verlag GmbH & Co KGaA, Weinheim ISBN: 3- 527- 4 039 7 -3 52 Weak Solutions of Conservation Laws direction coincides with the x- axis whereas the flow of ... Ansorge Copyright c 20 03 Wiley- VCH Verlag GmbH & Co KGaA, Weinheim ISBN: 3- 527- 4 039 7 -3 14 Ideal Fluids We ask for the change of ϕ d (x, y, z) with respect to time, i.e for W (t) d dt ϕ (x, y, z, ... therefore v (x( t), t) = v0 (x0 ) This can easily be verified by d v (x( t), t) = ∂t v (x( t), t) + x v (x( t), t) · x (t) dt = ∂t v (x, t) + x v (x, t) · f (v0 (x0 )) = ∂t v (x, t) + x v (x, t) · f (v (x, t))...
- 181
- 194
- 0
ion chromatography 3rd ed - j. fritz, t. gjerde (wiley-vch, 2000) ww
... Solvents 30 Ion-Exchange Resins 33 3. 1 3. 2 3. 2.1 3. 2.2 3. 2 .3 3.2.4 3. 2.5 3. 3 3. 3.1 3. 3.2 3. 3 .3 3 .3. 4 3. 3.5 3. 3.6 3. 3.7 3. 3.8 3. 3.9 3. 4 3. 4.1 3. 4.1.1 3. 4.1.2 3. 4.2 3. 4 .3 3.5 Introduction 33 Polymeric ... 6.2.7 6 .3 6 .3. 1 6 .3. 2 6 .3. 3 6 .3. 3.1 6 .3. 3.2 6 .3. 3 .3 6 .3. 3.4 6 .3. 3.5 6 .3. 3.6 6 .3. 4 6 .3. 5 6 .3. 6 6 .3. 6.1 6 .3. 7 6.4 6.4.1 6.4.2 Scope and Conditions for Separation 101 Columns 102 Separation Conditions ... Metals 233 Chromium 231 Iron 232 Arsenic 233 Tellurium 234 Selenium 23. 5 Vanadium 236 Tin 236 Mercury 237 Other Metals 237 12 Method Development 12.1 12.2 12.2.1 12.2.2 12 .3 12 .3. 1 12 .3. 2 Introduction...
- 264
- 269
- 0
organic molecular solids - m. schwoerer, h. wolf (wiley-vch, 2007) ww
... 3. 1 3. 2 Organic Molecular Solids M Schwoerer and H C Wolf Copyright © 2007 WILEY- VCH Verlag GmbH & Co KGaA, Weinheim ISBN: 978 -3- 527- 40540-4 42 Contents VIII 3. 3 3. 4 3. 5 Crystal Growth 63 Mixed ... Charge-Density Waves 31 4 Other Radical-ion Salts and CT Complexes 32 2 Radical-Anion Salts of DCNQI 32 3 Radical-Cation Salts of the Arenes 33 0 Direct-current Conductivity 33 0 X- Ray Scattering 33 4 Optical ... b1u b3g b2g b1u –2 .3 –1.62 –1 .30 –1.00 –0.62 +0.62 +1.00 +1 .30 +1.62 +2 .30 0 .30 0 0.2 63 0.400 0.425 0.425 0.400 0.2 63 0 .30 0 –0. 231 –0.425 –0.174 –0.408 –0.2 63 +0.2 63 +0.408 +0.174 +0.425 +0. 231 ...
- 432
- 395
- 0
organic nanostructures - j. atwood, j. steed - (wiley-vch, 2008) ww
... Edited by Jerry L Atwood and Jonathan W Steed Copyright Ó 2008 WILEY- VCH Verlag GmbH & Co KGaA, Weinheim ISBN: 978 -3- 527 -31 836 -0 XVI List of Contributors Marco Curzi Università di Bologna Dipartimento ... Architectures 145 Sensory Gels 147 Conductive Gels 147 Conclusions 148 References 148 5.1 5.2 5 .3 5 .3. 1 5 .3. 1.1 5 .3. 1.2 5 .3. 2 5 .3. 3 5 .3. 4 5 .3. 5 5 .3. 6 5 .3. 7 5 .3. 8 5.4 5.4.1 5.4.2 5.4 .3 5.4.4 5.4.5 5.4.6 5.4.7 ... from the Solid State 30 9 Summary and Outlook 31 2 References 31 3 13. 1 13. 2 13. 3 13. 3.1 13. 4 13. 5 14 14.1 14.2 14 .3 14.4 14.5 14.6 14.7 14.8 14.9 Organic Nanocapsules 31 7 Scott J Dalgarno, Nicholas...
- 371
- 206
- 0
atoms, radiation and radiation protection 3rd ed - j. turner (wiley-vch, 2007) ww
... and Exposure Limits 449 Objective of Radiation Protection 449 Elements of Radiation-Protection Programs 449 13 13. 1 13. 2 13. 3 13. 4 13. 5 13. 6 13. 7 13. 8 13. 9 13. 10 13. 11 13. 12 13. 13 13. 14 Contents ... Quantities 38 7 12 12.1 12.2 37 9 XI Contents XII Kerma 38 7 Microdosimetry 38 7 Specific Energy 38 8 Lineal Energy 38 8 12.11 Suggested Reading 38 9 12.12 Problems 39 0 12. 13 Answers 39 8 13. 15 13. 16 13. 17 ... Weinheim ISBN: 978 -3- 527- 40606-7 Contents VIII 3. 2 3. 3 3. 4 3. 5 3. 6 3. 7 3. 8 3. 9 3. 10 3. 11 Nuclear Binding Energies 58 Alpha Decay 62 65 Beta Decay (β – ) Gamma-Ray Emission 68 Internal Conversion 72...
- 593
- 286
- 0
Fischer tropsch fischer tropsch refining wiley VCH (2011)
... 247 XI XII Contents 12.5 Discussion of the Refinery Design 247 References 248 Part IV Synthetic Transportation Fuels 249 13 13. 1 13. 2 13. 3 13. 3.1 13. 3.2 13. 3 .3 13. 3.4 13. 3.5 13. 3.6 13. 3.7 13. 3.8 ... 461 23 23. 1 Chemical Technologies 465 Introduction 465 XV XVI Contents 23. 2 23. 2.1 23. 2.2 23. 2 .3 23. 2.4 23. 3 23. 3.1 23. 3.2 23. 3 .3 23. 3.4 Production of n-1-Alkenes (Linear α-Olefins) 466 Extraction ... 39 Petrochemical Refineries 43 Lubricant Base Oil Refineries 44 References 46 Part II Production of Fischer–Tropsch Syncrude 49 3. 1 3. 2 3. 2.1 3. 2.2 3. 3 3. 3.1 3. 3.2 3. 3 .3 3 .3. 4 3. 3.5 3. 4 3. 4.1 3. 4.2...
- 622
- 258
- 0
Báo cáo khoa học: Functional similarities between the small heat shock proteins Mycobacterium tuberculosis HSP 16.3 and human aB-crystallin docx
... J.I (1999) ATP and the core Ôalpha-crystallinÕ domain of the small 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 heat-shock protein alphaB-crystallin J Biol Chem 274, 30 190– 30 195 Clark, J.I & Muchowski, ... surviving cells expressing MTB HSP 16 .3 and controls without MTB HSP 16 .3 expression The results for MTB HSP 16 .3 are consistent with previous reports with other sHsps [ 23, 30 ,31 ] The protective ... HSP 16 .3 [d, CS alone; ,, HSP 16 .3 : CS (10 : 1) + mM KCl and 3. 5 mM MgCl2; s, HSP 16 .3 : CS (10 : 1); , HSP 16 .3 : CS (10 : 1) + 3. 5 mM ATPcS; j, HSP 16 .3 : CS (10 : 1) + 3. 5 mM ATP] Fig Comparison...
- 8
- 310
- 0
wiley http essentials protocols for secure scaleable web sites phần 3 ppt
... its request Accept: text/plain; q=0.5, text/html, text /x- dvi; q=0.8, text /x- c As you can see from the example, the Accept header can include a list of multiple content types Commas separate individual ... of seconds If, for example, a cache contained an object that would not expire for another 45 seconds, the cache server could not return the local copy in response to the request header example ... four different content encodings, all of which are listed in table 3. 7 Table 3. 7 HTTP Content-Encodings Identifier Meaning compress The encoding format produced by the UNIX program compress (Older...
- 33
- 204
- 0
Functional analysis of the nuage, a unique germline organelle, in drosophila melanogaster 3
... Transheterozygotes krimpf065 83/ Df(2R)Exel60 63 exhibited female sterility and a similar extent of loss in KRIMP perinuclear staining to that of homozygous krimpf065 83 (Appendix IV) Hence, krimpf065 83 was employed ... VHLVQRLPDGFLIRFLDDWKYIPEQLLQRNYAQVSQ b Figure 3. 1.1 KRIMP is a nuage component (a) Gene structure of krimp krimp contains two exons and is predicted to contain a coiled-coil domain, a CCCH-type zinc finger ... synaptonemal marker C (3) G, remained chromosomal (Figure 3. 1.5) This is in contrast to the wild-type oocyte nucleus, which compacts into a karyosome by stage and C (3) G dissociates to become extrachromosomal...
- 11
- 201
- 0
Wiley cryptography for internet and database applications sep 2002 ISBN 0471210293
... 1 23 124 125 125 125 126 126 127 129 131 131 132 133 134 134 135 135 136 137 141 141 141 142 1 43 1 43 1 43 144 144 144 145 146 Contents Developer Issues Reseeding Collecting Entropy An Entropy Pool ... Counter Mode (CTR) Propagating CBC (PCBC) Mode Key Wrapping Triple DES KEY Wrapping AES Key Wrapping Turning Passwords into Keys 21 22 22 22 24 25 28 29 31 31 35 35 36 36 37 37 39 39 40 41 43 ... 211 211 211 212 212 2 13 2 13 214 215 221 221 230 230 234 237 241 241 2 43 2 43 244 245 245 246 247 250 250 251 251 252 252 2 53 254 255 256 258 259 262 2 63 2 63 264 266 266 267 Contents Key Access and...
- 419
- 184
- 0
Wiley Inside Information Making Sense of Marketing Data.pdf
... Sussex, PO19 1UD, UK or e-mailed to permreq @wiley. co. uk or faxed to (+44) 12 43 770571 Other Wiley Editorial Offices John Wiley & Sons, Inc., 605 Third Avenue, New York, NY 10158-0012, USA WILEY- VCH ... WILEY- VCH Verlag GmbH Pappelallee 3, D-69469 Weinheim, Germany John Wiley & Sons Australia, Ltd, 33 Park Road, Milton, Queensland 4064, Australia John Wiley & Sons (Canada) Ltd, 22 Worcester Road Rexdale, ... of issues raised e.g A=safety B=price C=comfort etc X X X X ABC Order of frequency: Comfort 42% Speed 35 % Price 29% Image 28% AEF ACDE Margin of error BCD X + • Shape/direction of data/evidence...
- 270
- 1,083
- 1
John Wiley And Sons Wireless Networks eBook LiB
... Transport Protocol (L2TP) 12.7 .3 Internet Protocol Security (IPSec) 12.8 Summary References 32 7 32 7 32 8 33 0 33 1 33 4 33 5 33 6 33 7 33 7 33 8 33 8 33 9 13 Simulation of Wireless Network Systems 13. 1 Basics ... 38 2 38 2 38 3 38 3 38 4 38 5 38 5 38 7 38 7 38 8 38 8 38 9 39 1 39 1 39 3 39 6 39 7 39 7 Index 39 9 35 7 36 0 36 6 Preface The field of wireless networks has witnessed tremendous growth in recent years and it has become ... Summary WWW Resources References Further Reading 299 299 299 30 1 30 2 30 3 30 3 30 3 30 6 30 7 30 9 31 0 31 1 31 3 31 4 31 5 31 6 31 8 31 8 32 3 32 5 32 5 32 5 12 Security Issues in Wireless Systems 12.1 The Need for...
- 418
- 638
- 3
John.Wiley.And.Sons.Marketing.Insights.From.A.To.Z.eBook-LiB.pdf
... late Roberto Goizueta, CEO of Coca-Cola, recognized Coke’s competitors When his people said that Coke’s market share was at a maximum, he countered that Coca-Cola accounted for less than ounces ... will have to answer whether you want Coca-Cola Classic, Caffeine Free CocaCola Classic, Diet Coke, Diet Coke with Lemon, Vanilla Coke, or Brands 13 Cherry Coke—and you want it in a can or a bottle? ... Change 16 Communication and Promotion 18 Companies 20 Competitive Advantage 22 Competitors 23 Consultants 25 Corporate Branding 26 Creativity 27 Customer Needs 30 Customer Orientation 32 Customer...
- 226
- 1,421
- 7
John Wiley And Sons Another Word A Day
... cm Includes bibliographical references and index ISBN 13 978-0-471-71845-1 (pbk.) ISBN 10 0-471-71845-9 (pbk.) ISBN 13 978-0-471-77878 -3 (cloth) ISBN 10 0-471-77878-8 (cloth) Vocabulary English ... nosology ● idiopathy 30 Numeric Terms sixty-four-dollar question deep-six ● catch-22 115 ● honcho 118 ● placebo ● nyctalopia 1 23 ● eighty-six ● twenty-twenty ● x CONTENTS 31 Kangaroo Words indolent ... (800) 762-2974, outside the United States at (31 7) 572 -39 93 or fax (31 7) 572-4002 Wiley also publishes its books in a variety of electronic formats Some content that appears in print may not be available...
- 241
- 698
- 19
John Wiley And Sons Complete Q And A Job Interview Book
... (800) 762-2974, outside the United States at (31 7) 572 -39 93 or fax (31 7) 572-4002 Wiley also publishes its books in a variety of electronic formats Some content that appears in print may not be available ... to the Permissions Department, John Wiley & Sons, Inc., 111 River Street, Hoboken, NJ 07 030 , (201) 748-6011, fax (201) 748-6008, e-mail: permcoordinator @wiley. com Limit of Liability/Disclaimer ... the appropriate per-copy fee to the Copyright Clearance Center, Inc., 222 Rosewood Drive, Danvers, MA 019 23, (978) 750-8400, fax (978) 750-4470, or on the Web at www.copyright.com Requests to the...
- 258
- 1,298
- 10
John Wiley And Sons Webster's New World - Essential vocabulary
... Review Review #26 #27 #28 #29 #30 E Quick Review #31 Quick Review #32 Quick Review #33 Quick Review #34 Quick Review #35 Quick Review #36 Quick Review #37 Quick Review #38 ... 31 4 31 6 31 9 32 2 Q–R Quick Review #118 Quick Review #119 Quick Review #120 32 3 32 4 32 7 32 9 Contents xiii S ... at 31 7-572 -39 93 or fax 31 7-572-4002 Wiley also publishes its books in a variety of electronic formats Some content that appears in print may not be available in electronic books Library of Congress...
- 402
- 653
- 6
Wiley Finance Series Option Theory
... equations by LU decomposition A.11 Cubic spline A.12 Algebraic results A. 13 Moments of the arithmetic mean A.14 Edgeworth expansions 299 299 30 9 31 4 31 8 32 2 32 5 32 9 33 6 34 4 34 7 34 9 35 1 35 3 35 6 Bibliography ... jargon 20.2 Expectations 20 .3 Conditional expectations applied to the one-step model 20.4 Multistep model 20.5 Portfolios 20.6 First approach to continuous time 233 233 234 235 237 238 240 21 Brownian ... the x- axis by the future value of the premium Similarly, short positions would be shifted up through the x- axis Call Spread X1 X2 Short Put Spread (P1 - P2 ) e r T (X - X ) X Box Spread X1 X X2...
- 388
- 532
- 2
Mạch điện tử - chương 7 - OP-AMP-Khuếch đại và ứng dụng
... Tám VII -3 Mạch Điện Tử Chương 7: OP -AMP_ Khuếch đại ứng dụng 7.1 .3 Một ví dụ: Op -amp μpc 709 hảng Fairchild T1, T2: Mạch vi sai ngõ vào T3: Nguồn dòng điện cho T1 T2 Ðiện phân cực cực T3 x c định ... OP -AMP_ Khuếch đại ứng dụng 7.2 .3 Op -amp phân cực nguồn đơn: Phần đặc tính mạch khuếch đại khảo sát op -amp phân cực nguồn đối x ng Thực tế, để tiện thiết kế mạch sử dụng, khơng cần thiết op -amp ... Chương 7: OP -AMP_ Khuếch đại ứng dụng 7 .3. 2 Mạch so sánh: a/ Ðiện ngõ bảo hòa: Ta xem mạch hình 7.20 lớn Trong A độ lợi vòng hở op -amp Vì A lớn nên theo công thức v0 Khi Ed nhỏ, v0 x c định Khi...
- 43
- 6,868
- 14
Tìm thêm: khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25