0

cty đông y học bảo lâm

Báo cáo y học:

Báo cáo y học: "Endoscopic laminoforaminoplasty success rates for treatment of foraminal spinal stenosis: report on sixty-four cases"

Y khoa - Dược

... laminoforaminoplasty for the treatment of refractory foraminal stenosis. Results: Fifty-nine percent of patients had at least 75% improvement in Oswestry Disability Index (Oswestry) and Visual Analog ... decompression may be carried out via a midline ap-proach, which may be performed as interlaminar ex-posure, laminotomy, laminectomy, medial facetec-tomy, medial foraminotomy, or muscle-splitting ... documented by magnetic reso-nance imaging (MRI) or computerized tomography (CT) and symptoms noted on physical exam. Patients with stenosis due to either intervertebral disc or boney compression...
  • 4
  • 463
  • 0
Tài liệu Đông y có thể làm giảm cân không? pptx

Tài liệu Đông y có thể làm giảm cân không? pptx

Thời trang - Làm đẹp

... niệm của Đông Y về béo phì: Đông y từ 2000 năm trước đã phân loại: nhân hữu phì, hữu cao, hữu nhục tức là có 3 loại người: nhiều mỡ, nhiều xương và nhiều nạc. Với béo phì các lương y th y có hiện ... như v y nên một bài thuốc được xem là “giảm béo” thường có những vị cơ bản sau: Vì có hiện tượng khí trệ huyết ứ nên trong bài thuốc cần có vị hoạt huyết như Đan sâm. Đan sâm ng y nay được ... trệ huyết ứ”, béo phì do bộ tiêu hóa và hấp thu tốt làm nặng gánh tỳ vị thì cần kiện tỳ hóa đàm. V y những vị thuốc có tác dụng giảm béo thường được dùng như thế nào?Vì lý luận của Đông y như...
  • 2
  • 437
  • 2
Báo cáo y học:

Báo cáo y học: "Endoscopic thoracic laminoforaminoplasty for the treatment of thoracic radiculopathy: report of 12 case"

Y học thưởng thức

... laminotomy with similar success rates. Patients additionally benefit from a decrease risk of complications, short hospital stay, and faster recovery. Key words: thoracic, radiculopathy, laminoforaminoplasty, ... (VAS) and Oswestry Dis-ability Index, respectively. The significance was 0.005 between the pre and post surgical data. One patient with moderate symptoms, two with severe symptoms, and two ... to surgery, all patients were treated with conservative therapy, in-cluding physical therapy and epidural steroid injec-tions, which failed to provide adequate relief. The surgery commenced...
  • 3
  • 506
  • 0
TIỂU LUẬN SINH SẢN VÀ PHÁT TRIỂN CÁ THỂ ĐỘNG VẬT “ Tìm hiểu tế bào gốc và ứng dụng của tế bào gốc trong y học”

TIỂU LUẬN SINH SẢN VÀ PHÁT TRIỂN CÁ THỂ ĐỘNG VẬT “ Tìm hiểu tế bào gốc và ứng dụng của tế bào gốc trong y học”

Sinh học

... nhy cm hn vi insulin. Vic b sung thờm loi thuc iu tr tiu ng ny vo vic húa tr truyn thng cho thy trin vng iu tr v trỡ hoón cn bnh ung th vỳ, cú th lm gim 60% nguy c phỏt trin ung th tuyn ty ... duy trỡ trong trng thỏi tnh hay khụng phõn chia cho n khi c hot hoỏ do s tn thng mụ hay bnh tt. Cỏc nh khoa hc bit rng vic gene úng hay m l yu t quyt nh cho quỏ trỡnh bit hoỏ v cỏc t bo ny ... cú s phc hi chc nng vn ng. Kt qu mi ny ó a ra bng chng cú s thay i c bn ng dn truyn thn kinh sau vi thỏng iu iu tr.Phỏt hin mi ny cho thy l cỏc t bo nguyờn bn ni sinh cú th gúp phn vo vic...
  • 46
  • 1,451
  • 4
Tài liệu Báo cáo Y học: Role of electrostatics in the interaction between plastocyanin and photosystem I of the cyanobacterium Phormidium laminosum ppt

Tài liệu Báo cáo Y học: Role of electrostatics in the interaction between plastocyanin and photosystem I of the cyanobacterium Phormidium laminosum ppt

Báo cáo khoa học

... thermodynamic analysis by laser-flash absorptionspectroscopy of photosystem I reduction by plastocyanin andcytochrome c6in Anabaena PCC 7119, Synechocystis PCC 6803,and spinach. Biochemistry 35, ... De la Rosa, M.A. & Tollin,G. (1994) A thermodynamic study by laser-flash photolysis ofplastocyanin and cytochrome c6oxidation by photosystem I fromthe green alga Monoraphidium braunii. ... &Bottin, H. (1994) Laser flash kinetic analysis of Synechocystis PCC6803 cytochrome c6and plastocyanin oxidation by photosystem I.Biochim. Biophys. Acta 1184, 235–241.22. De la Cerda, B.,...
  • 10
  • 673
  • 0
Tài liệu Báo cáo Y học: The binding of lamin B receptor to chromatin is regulated by phosphorylation in the RS region ppt

Tài liệu Báo cáo Y học: The binding of lamin B receptor to chromatin is regulated by phosphorylation in the RS region ppt

Báo cáo khoa học

... Biology, Graduate School of Science and Technology, Niigata University, Japan;3Department of Biochemistry, Faculty of Science, Niigata University, Japan;4Laboratory of Applied Molecular Biology, ... larifying the p hysiological function of thephosphorylation, and such work is currently underway.It was suggested that the binding of LBR to spermchromatin is strongly suppressed by phosphorylation ... thosereported by Ye et al. [22]. On the o ther hand, James et al.reported t hat HP1 is not observed in the nuclei o f e arlysyncytial e mbryos, but becomes concentrated in the nucleiat the syncytial...
  • 11
  • 563
  • 0
Báo cáo Y học: Two independent, light-sensing two-component systems in a filamentous cyanobacterium pot

Báo cáo Y học: Two independent, light-sensing two-component systems in a filamentous cyanobacterium pot

Báo cáo khoa học

... recombinant phytochrome of the cyanobacteriumSynechocystis. Biochemistry 36, 13389–13395.18. Yeh, K C., Wu, S H., Murphy, J.T. & Lagarias, J.C. (1997) Acyanobacterial phytochrome two-component ... Talonmetal affinity resin (Clontech). The analysis of proteincontent and purity was performed by polyacrylamide gelelectrophoresis and Western blotting (PHAST system,Pharmacia) employing an anti ... photochemistry is apparentlynot restricted to the prokaryotic phytochromes, but also aplant phytochrome apoprotein (apo-phyA of oat) canincorporate a PCB-like chromophore with photochemicalactivity,...
  • 10
  • 499
  • 0
Báo cáo Y học: High affinity binding between laminin and laminin binding protein of Leishmania is stimulated by zinc and may involve laminin zinc-finger like sequences doc

Báo cáo Y học: High affinity binding between laminin and laminin binding protein of Leishmania is stimulated by zinc and may involve laminin zinc-finger like sequences doc

Báo cáo khoa học

... Zn2+andfree sulfhydryls may be required for LBP binding site onlaminin a s e videnced by the stimulatory and inhibitoryeffects of ZnCl2and N-ethylmaleimide, respectively. Prein-cubating ... sequence.Alternatively, the proteins may be phosphorylated byanother unknown phosphotyrosine kinase. As an antibodydirected against the 67-kDa LBP can induce tyrosinephosphorylation of these proteins, ... not show any inhibitoryactivity (data n ot shown). A ll these molecules with adher-ence inhibitory activity could effectively block lamininbinding to LBP (Table 2).Tyrosine phosphorylation through...
  • 8
  • 420
  • 0
BÁO CÁO

BÁO CÁO " TÌNH HÌNH ÁP DỤNG CÁC BIỆN PHÁP VỆ SINH THÚ Y ĐẢM BẢO AN TOÀN SINH HỌC TẠI MỘT SỐ CƠ SỞ CHĂN NUÔI LỢN TRÊN ĐỊA BÀN HUYỆN GIA LÂM " pdf

Báo cáo khoa học

... pháp vệ sinh thú y đảm bảo an ton sinh học tại một số cơ sở chăn nuôi lợn trên địa bn huyện Gia Lâm Situation of Application of Veterinary Hygiene Measures for Biosecurity on Pig Farms in ... ln, v sinh thỳ y. SUMMARY A survey was carried out on 45 pig farms in Gia Lam district to investigate the level of application of veterinary hygiene measures for farm biosecurity. Results showed ... level, the application of veterinary hygiene measures in most them was assessed as average and poor. Key words: Bio-security, feed, pig farms, veterinary hygiene. 1. ĐặT VấN Đề Trong quá trình...
  • 6
  • 729
  • 0
Báo cáo Y học: Intracellular pH homeostasis in the filamentous fungus Aspergillus niger pdf

Báo cáo Y học: Intracellular pH homeostasis in the filamentous fungus Aspergillus niger pdf

Báo cáo khoa học

... during the stationaryphase, and lost their viability relatively quickly. Increasedpolyphosphate synthesis may therefore greatly enhance thechances of survival in stationary phase cells. If so, ... permeability the energycosts to maintain such large DpHs are relatively low. Thismeans that physical protection by the cytoplasmic mem-brane alone may be sufficient to keep pHcytclose toneutrality ... steady-state pHcytvalues of2- and 7-day-old mycelium (7.53 ± 0.05 and 7.54 ± 0.04,respectively) although cytoplasmic phosphate, sugar phos-phate and ATP levels were clearly higher in 2-day-oldmycelium....
  • 10
  • 535
  • 0
Báo cáo Y học: A neuropeptide Y receptor Y1-subfamily gene from an agnathan, the European river lamprey doc

Báo cáo Y học: A neuropeptide Y receptor Y1-subfamily gene from an agnathan, the European river lamprey doc

Báo cáo khoa học

... mammals; Y1 , Y2 , Y4 , Y5 and y6 , most of which have high affinities for NPY andPYY. Y4 is the only receptor for which PP has higheraffinity than NPY or PYY. The y6 gene still lacks a physio-logical ... (MPPKPDNPSSDASPEELSKYMLAVRNYINLITRQRY-NH2), PYY (FPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRY-NH2) and NPY (FPNKPDSPGEDAPAEDLARYLSAVRHYINLITRQRY-NH2weresynthesized by solid-phase methodology on a 0.025-mmolscale ... receptor; Lamprey.Neuropeptide Y (NPY), peptide YY (PYY) and pancreaticpolypeptide (PP) are closely related 36-amino-acid neuro-endocrine peptides found in all tetrapods. NPY and PYYhave also...
  • 9
  • 290
  • 0
Nghiên cứu khoa học

Nghiên cứu khoa học " Đất làm nương rãy luân canh của đồng bào dân tộc thiểu số ở miền núi " pot

Cao đẳng - Đại học

... đất lâm nghiệp, kiểm lâm không giao đất nương r y cho hộ gia đình, nhưng với mục đích bảo vệ rừng, đã quy vùng làm nương r y cho các thôn bản, có thể hiểu đất đó là vô chủ, tự do làm nương r y. ... loại đất n y) . - Còn ngành lâm nghiệp cũng không coi đất làm nương r y luân canh là đất lâm nghiệp quản lý, với lý do: sử dụng đất không đúng mục đích lâm nghịêp, mặc dù đất nương r y đó đều ... nghiệp quy hoạch để x y dựng và phát triển rừng phòng hộ đầu nguồn ít xung y u, phân tán không đủ điều kiện thành lập Ban quản lý rừng phòng hộ, (ii) Đất lâm nghiệp quy hoach để x y dựng và...
  • 6
  • 575
  • 2

Xem thêm

Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose