Ngày tải lên: 17/03/2014, 06:20
Ngày tải lên: 20/02/2014, 12:20
Tài liệu Báo cáo khoa học: "Learning Word Senses With Feature Selection and Order Identification Capabilities" pdf
Ngày tải lên: 20/02/2014, 16:20
Báo cáo hóa học: " Research Article Blind Identification of FIR Channels in the Presence of Unknown Noise" docx
Ngày tải lên: 22/06/2014, 23:20
Tài liệu Báo cáo khoa học: Identification of Ewing’s sarcoma protein as a G-quadruplex DNA- and RNA-binding protein ppt
... APKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGP GGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPP GPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY K. Takahama et al. Identification of Ewing’s sarcoma protein FEBS Journal 278 (2011) 988–998 ª 2011 The Authors Journal compilation ª 2011 FEBS 991 Identification of Ewing’s sarcoma ... labeled DNA. The DNA–protein complexes were resolved by 6% PAGE and visualized by autoradiography. Identification of Ewing’s sarcoma protein K. Takahama et al. 992 FEBS Journal 278 (2011) 988–998 ... DNA–protein complexes were resolved by 6% PAGE and visu- alized by autoradiography. K. Takahama et al. Identification of Ewing’s sarcoma protein FEBS Journal 278 (2011) 988–998 ª 2011 The Authors Journal...
Ngày tải lên: 15/02/2014, 01:20
Tài liệu Báo cáo khoa học: Identification and characterization of the transcription factors involved in T-cell development, t-bet, stat6 and foxp3, within the zebrafish, Danio rerio docx
... discovery, the Ginbuna crucian carp sequence was unknown. This approach enabled t-bet and foxp3 to be obtained quickly, as a major difficulty in the identification of transcription factors is that Table ... 169–182. 84 Zou J, Carrington A, Collet B, Dijkstra JM, Yoshiura Y, Bols N & Secombes C (2005) Identification and bioactivities of IFN-gamma in rainbow trout Oncorhyn- chus mykiss: the first Th1-type ... genome. The zebrafish gen- ome was searched using the human stat6 amino acid sequence directly for identification. The zebrafish t-bet homologue is predicted to contain 609 amino acids, the stat6 homologue...
Ngày tải lên: 16/02/2014, 09:20
Tài liệu Báo cáo khoa học: The cellulosomes from Clostridium cellulolyticum Identification of new components and synergies between complexes ppt
... xylanase F1 fraction combined with either the Table 1. Identification of specific components detected in fractions F1, F5 and F6 using MS analysis. All identifications were based on pep- tide mass fingerprint ... acquisition. Maximum coverage identification was carried out using the big three program included in the data acquisition Xcali- bur Ô Finnigan proteomex 2.0 software program. Protein identification was performed ... (http://www.cazy.org); Doc, dockerin domain; Ig, immunoglobulin-like domain of cellulase; X2, Ig-like module of unknown func- tion; M r , theoretical molecular mass of the mature protein. The cleavage site was...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: Identification of two late acyltransferase genes responsible for lipid A biosynthesis in Moraxella catarrhalis doc
... antisense) [19] Identification of M. catarrhalis lpxX and lpxL S. Gao et al. 5206 FEBS Journal 275 (2008) 5201–5214 Journal compilation ª 2008 FEBS. No claim to original US government works Identification ... Bacteriol 179, 5521–5533. 33 McLendon MK, Schilling B, Hunt JR, Apicella MA & Gibson BW (2007) Identification of LpxL, a late acyl- transferase of Francisella tularensis. Infect Immun 75, 5518–5531. 34 ... lipooligosaccharide from Moraxella catarrhalis conjugated to proteins. Infect Immun 68, 4980–4985. Identification of M. catarrhalis lpxX and lpxL S. Gao et al. 5214 FEBS Journal 275 (2008) 5201–5214...
Ngày tải lên: 18/02/2014, 14:20
Tài liệu Báo cáo khoa học: Identification and characterization of an R-Smad ortholog (SmSmad1B) from Schistosoma mansoni pdf
... this study, we report the identification of SmSmad1B cDNA and present its gene structure along with the expression profiles, immunolocalization, and protein interaction properties. Results Identification of ... implication that host molecules may be exploited by schistosomes to enhance the parasites’ development Keywords bone morphogenic protein; Schistosoma mansoni; Smad; transforming growth factor-b Correspondence P. ... levels by approximately 45% in the later stages (35 days or older) of mammalian develop- ment [6]. Identification and immunolocalization of SmSmad1B protein in adult schistosomes To detect the native...
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Identification, sequencing, and localization of a new carbonic anhydrase transcript from the hydrothermal vent tubeworm Riftia pachyptila docx
... of carbonic anhydrase. Mar Biol 100, 195–202. 14 Kochevar RE, Govind NS & Childress JJ (1993) Identification and characterization of two carbonic anhydrases from the hydrothermal vent tubeworm Riftia ... et al. 5316 FEBS Journal 274 (2007) 5311–5324 ª 2007 The Authors Journal compilation ª 2007 FEBS Identification, sequencing, and localization of a new carbonic anhydrase transcript from the hydrothermal vent ... organ, where it is immediately converted into bicarbonate through high activities of carbonic Keywords chemoautotrophy; differential expression; messenger RNA; symbiosis; Siboglinidae Correspondence F....
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Identification of differentially expressed genes of the Pacific oyster Crassostrea gigas exposed to prolonged thermal stress docx
... (2007) 6392–6402 Journal compilation ª 2007 FEBS. No claim to original French government works Identification of differentially expressed genes of the Pacific oyster Crassostrea gigas exposed to ... ranging from 4 to 24 °C [8]. In the coldest regions inhabited by C. gigas, such as Brittany, Keywords climate; Crassostrea gigas; gene expression; heat stress; prolonged thermal stress Correspondence M....
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Suppressed catalytic efficiency of plasmin in the presence of long-chain fatty acids Identification of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation ppt
... overall catalytic outcome may vary with the concentration of the substrate. The approach used for the identification of kinetic parameters in this study exploited the advantages of progress curve evaluation ... distribution of the parameters estimated using this robust evaluation procedure was essential for the identification of the statistical significance of the described effects. In con- clusion, our study ... such conditions the mathematical procedure operating with K i and J 3 is an indispensable tool in identification of the k p and K m values because it is able to eliminate the super- imposed assay-dependent...
Ngày tải lên: 18/02/2014, 17:20
Tài liệu Báo cáo khoa học: Identification of a novel matrix protein contained in a protein aggregate associated with collagen in fish otoliths pdf
... 483–489. 16 Perkins DN, Pappin DJC, Creasy DM & d Cottrell JS (1999) Probability-based protein identification by searching sequence databases using mass spectrometry data. Electrophoresis 20, ... of the sacculus, by contrast, mRNA hybrid- ization signals were barely detectable (Fig. 2C,D). Identification of the calcium-binding domain in OMM-64 To determine the regions that have calcium-binding activity, ... framework FEBS Journal 275 (2008) 2512–2523 ª 2008 The Authors Journal compilation ª 2008 FEBS 2515 Identification of a novel matrix protein contained in a protein aggregate associated with collagen...
Ngày tải lên: 18/02/2014, 17:20
Tài liệu Báo cáo khoa học: Direct identification of hydrophobins and their processing in Trichoderma using intact-cell MALDI-TOF MS docx
... well-known hydrophobins were suspected to be the signal source, and some were assigned by database analysis. Identification of the class II hydrophobins produced by H. jecorina In order to identify the already ... highly abundant intracellular constituents [22]. This set of about 10–30 defined masses permits the identification at the species and subspecies ⁄ strain level. We here show that in filamen- tous fungi, ... ubiquitins. The sensitivity of detection employing the MALDI-TOF technique can be expec- ted to allow the identification of bacterial peptides with 100 microbial cells. Experimental procedures Reagents...
Ngày tải lên: 19/02/2014, 02:20
Tài liệu Báo cáo khoa học: Identification of b-amyrin and sophoradiol 24-hydroxylase by expressed sequence tag mining and functional expression assay docx
... cerevisiae yielded olean-12-ene-3b,24-diol. This is the first identification of triterpene hydroxylase cDNA from any plant species. Successful identification of a b-amyrin and sophoradiol 24-hydroxy- lase ... enzymes, it was unex- pected that CYP93E1 would encode b-amyrin and sophoradiol 24-hydroxylase. The identification of CYP93E1 as triterpene hydroxylase implies that the function of other members of ... CYP93E1 FEBS Journal 273 (2006) 948–959 ª 2006 The Authors Journal compilation ª 2006 FEBS 949 Identification of b-amyrin and sophoradiol 24-hydroxylase by expressed sequence tag mining and functional expression...
Ngày tải lên: 19/02/2014, 07:20
Tài liệu Báo cáo khoa học: Identification of GAS-dependent interferon-sensitive target genes whose transcription is STAT2-dependent but ISGF3-independent doc
... activation 22.5 Hypothetical ⁄ unknown (10) FLJ21198 fis, clone COL00220 Function unknown 58.0 ESTs, Moderately similar to G02654 ribosomal protein L39 Function unknown 44.7 mRNA for KIAA0550 ... protein 35.0 PAR5 gene Similar to small nuclear ribonucleoprotein polypeptide N, function unknown 30.5 Unknown clone 12262, mRNA Similar to translocase of inner mitochondrial membrane 8 homolog ... and FccRI, have been identified to date [10]. Microarray gene expression analyses have led to the identification of numerous ISGs and have implicated IFNs in activities as diverse as cell adhesion,...
Ngày tải lên: 19/02/2014, 07:20
Tài liệu Báo cáo khoa học: Identification of membrane-bound serine proteinase matriptase as processing enzyme of insulin-like growth factor binding protein-related protein-1 (IGFBP-rP1/angiomodulin/mac25) doc
... Maile LA & Holly JM (1999) Insulin-like growth binding protein (IGFBP) proteolysis: occurrence, identification, role and regulation. Growth Horm IGF Res 9, 85–95. 25 Collett-Solberg PF & Cohen ... Coughlin SR & Craik CS (2000) Cellular localization of membrane-type serine protease 1 and identification of protease-activated receptor-2 and single-chain urokinase-type plasminogen activator ... Glycobiology 14, 139–146. 35 Shi YE, Torri J, Yieh L, Wellstein A, Lippman ME & Dickson RB (1993) Identification and characterization of a novel matrix-degrading protease from hormone- dependent...
Ngày tải lên: 19/02/2014, 07:20
Tài liệu Báo cáo khoa học: Bioinformatics of the glycoside hydrolase family 57 and identification of catalytic residues in amylopullulanase from Thermococcus hydrothermalis doc
... the proposed conserved sequen ce regions (Fig. 1), our alignment constitutes a valid base for the identification o f other f unctional r esidues i n both the present and future GH-57 members. Acknowledgements The ... bonds. The align- ment and mutagenesis strategy employed by v an Lieshout et al . [36] allowed the identification of Glu117 as the catalytic nucleophile (analogous to residue Glu123 in O32462_ THELI ... 248, 171–178. 35. Imamura, H., Fushinobu, S., Jeon, B.S., Wakagi, T. & Matsuzawa, H. (2001) Identification of t he catalytic residue of Thermococcus litoralis 4-a-glucanotransferase through...
Ngày tải lên: 19/02/2014, 12:20
Tài liệu Báo cáo khoa học: What makes biochemical networks tick? A graphical tool for the identification of oscillophores ppt
... method, illustrating two new main classes of oscillophore topologies. Keywords: graph-theoretic approach; kinetic mode lling; oscillations; s ystem identification; systems biology. Oscillatory biochemical networks ... at it considers positive and negative interactions in a unified manner. The implication o f the identification o f an oscillophoretic subgraph is that if such a subgraph is found in a large network, ... negative one-step influences (Eqn 9a) and any number of positive one-step influences (Eqn 8). In other words, if the number of Ôeven cyclesÕ in the combination is even, this combination contributes to...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Minimally Supervised Event Causality Identification ppt
Ngày tải lên: 19/02/2014, 18:20
Bạn có muốn tìm thêm với từ khóa: