adding entities and relationships to a core data model
Tài liệu Preparedness and Response to a Mass Casualty Event Resulting from Terrorist Use of Explosives pdf
... challenges and barriers in communication, organizational response, standards of care, and surge capacity Meta-leaders build and maintain relationships and establish clear channels of communication ... develop a planning framework (surge capacity and capability map) that presents all available and relevant internal and external resources This framework should be transparent, updated, and shared ... hospitals will face in a mass casualty event (MCE) include surge capacity and capability issues in emergency and trauma services, as well as medical, paramedical, administrative, logistical, and...
- 36
- 478
- 0
Tài liệu C++ Lab2 Sending the output to a printfile Data Types pptx
... You can substitute the data type used inside the parenthesis Before manipulating a variable, you must assign a value to it You can assign a value at the time you declare a variable – we call this ... values such as grades from a test We will be studying compound data types and user defined data types later Declaring data types enables the compiler to set aside necessary amount of memory storage ... return 0; } And here is the output C++ Data Types There are simple data types such as integer, float, double, char, Bool etc that can only hold one value at a time Compound data types can have multiple...
- 6
- 400
- 0
Tài liệu C++ Lab 2 Sending the output to a printfile Data Types: Chapter 2 ppt
... dollars % 10 calculate dime rolls and remainder dime_rolls = remainder / remainder = remainder % calculate nickel rolls and remainder nickel_rolls = remainder / remainder = remainder % calculate ... the main int dollar, quarterR, dimeR, nickelR, pennyR, remainder; Variables that are used in the main are declared There are six variables of type integer These variable names (identifiers) stand ... problem What are the known information about this programming assignemnt? There are ten dollars in a quarter roll There are five dollars in a dime roll There are two dollars in a nickel roll And there...
- 13
- 358
- 0
Tài liệu Báo cáo khoa học: "DESIGN AND IMPLEMENTATION OF A LLXICAL DATA BASE " docx
... realized in this language To give an example, both arrival and arrivation are potential English words, but only the second happens to be an actual English word Turning then to what appears to ... For instance, a translation system or any other type of natural language processing program that must be able to handle very large amounts of text necessitates dictionaries of substantial size, ... morphological parser In fact, it makes lexical analysis rather trivial, equating it with a fairly simple database query It follows that the process of retrieving an irregular word is identical to the...
- 8
- 535
- 0
Upgrading IBM Systems Director Server on Windows and migrating to a Microsoft SQL Server or Microsoft SQL Server Express database Version 6 Release 3 pptx
... default database v Migrate your default Apache Derby database to the default managed IBM DB2 database and then switch your database to a non-default database The upgrade process automatically ... your database to any type of non-default database, you cannot migrate your database data Related tasks: Configuring the database Determining your database migration path Switching the database to ... Systems Director 6.3.x and want to use the managed IBM DB2 database instead When you switch your database to the default managed IBM DB2 database, you can migrate your database data to the managed IBM...
- 66
- 600
- 0
Báo cáo hóa học: " Research Article Design and Implementation of a Lightweight Security Model to Prevent IEEE 802.11 Wireless DoS Attacks" pdf
... 802.11 standard notations [1, 27] are used which are identified in Table In the IEEE 802.11 standard, except for the unicast data and management frames that are transmitted in the normal data rates, ... on Broadband Wireless Services and Applications (BWSA ’04), San Jose, Calif, USA, 2004 [6] M A Khan and A Hasan, “Pseudo random number based authentication to counter denial of service attacks ... overall computation and implementation process, legacy compatibility, high accuracy, and small security cost and communication overhead are the substantial advantages of the ACFNC model which make...
- 16
- 648
- 1
Báo cáo hóa học: " Research Article Implementation and Validation of a New Combined Model for Outdoor to Indoor Radio Coverage Predictions" pptx
... 3D database but a 2.5D database, in a dat format similar to the one used by commercial RO software After calibration based on the approach detailed in Section 3.3, it was verified that it was suitable ... rays from the transmitter Signal strength degenerates as the rays propagate and additional loss is added when rays reflect or diffract from walls; (ii) ray Tracing traces the rays backwards, that ... 345–348, Amsterdam, The Netherlands, October 2004 [26] M Thiel and K Sarabandi, “3D-wave propagation analysis of indoor wireless channels utilizing hybrid methods,” IEEE Transactions on Antennas and...
- 9
- 439
- 0
Báo cáo y học: "Shared expression of phenotypic markers in systemic sclerosis indicates a convergence of pericytes and fibroblasts to a myofibroblast lineage in fibrosis" pdf
... antisera and participated in drafting the manuscript CPD provided the clinical data and analysis CMB participated in drafting the manuscript DJA contributed to study design, data analysis and drafting ... camera Microvascular damage was analysed and quantified using the criteria established by Cutolo et al Essentially, dcSSc patients were graded as having an early (E), active (A) or late (L) pattern ... capillaries are present ((b) arrow) accompanied by moderate capillary loss and disorganisation of capillary architecture Late disease pattern was characterized by severe capillary disorganisation with...
- 11
- 397
- 0
Báo cáo y học: "Molecular model of the outward facing state of the human P-glycoprotein (ABCB1), and comparison to a model of the human MRP5 (ABCC5)" docx
... ABCB1 ABCB5 ABCB11 ABCC12 ABCC11 ABCC5 ABCC7 ABCC4 ABCC3 ABCC1 ABCC2 ABCC6 ABCC9 ABCC8 ABCC10 ABCA7 ABCA1 ABCA4 ABCA2 ABCA3 ABCA13 ABCA12 ABCA10 ABCA9 ABCA6 ABCA5 ABCG4 ABCG1 ABCG2 ABCG8 ABCG5 ABCD2 ... ABCC, ABCD and ABCG Two main branches are seen, with ABCB, ABCC and ABCD in one branch, and ABCA and ABCG in the other branch ABCB and ABCC subfamilies are closer related to each other than to ... have indicated that TMH6 and TMH12 may take part in ligand binding [26,27,30,31] Cross-linking has also shown that TMH5 and TMH8 are near each other [28], and that TMH2 and TMH11 are near each...
- 13
- 289
- 0
a cross-cultural study on american-vietnamses verbal expressions in offering a gift and responding to a gift offer = nghiên cứu giao thoa văn hóa việt - mỹ về cách sử dụng ngôn từ để tặng quà và nhận quà
... For example: they have the same age range (24-61); they all are living in the urban; and to some extent, they have the same educational background II.4 Coding of the data and mode of data analysis ... gifts and responding to gift offers in Vietnamese and American languages and cultures from cross – cultural perspective In fact, what to say to give a gift, and how to respond to a gift offer are ... their own and their interlocutors’ expectations of communication I.2 Language and culture Anna Wierzbicka (1992:371) regards “language as a mirror of culture and national character.” People can understand...
- 67
- 1,456
- 4
A cross – cultural study on american – vietnamese verbal expressions in offering a gift and responding to a gift offer
... language and culture The study aimed to get the answers to the following question: What are the similarities and differences in American and Vietnamese when offering a gift and responding to a ... happiness, good health and big success.” What was wrong in that situation? The American teacher was completely reasonable in his behavior and there was nothing grammatically wrong in the monitor’s ... limited to the verbal aspects of the act of offering gifts Nonverbal aspects of the act such as paralanguage, extra-language and the like are not investigated Conclusions will be based on the analysis...
- 7
- 1,214
- 21
Exergoeconomic optimization and improvement of a cogeneration system modeled in a process simulator using direct search and evolutionary methods
... Exergy accounting: Capabilities and drawbacks Energy 2006, 31(1), 164-180 Giannantoni C., Lazzaretto A. , Macor A. , Mirandola A. , Stoppato A. , Tonon S., Ulgiati S Multicriteria approach for the improvement ... 1972 Holland J.H Adaptation in Natural and Artificial Systems The University of Michigan Press: Ann Arbor, 1975 Okamoto M., Nonaka T., Ochiai S., Tominaga D Nonlinear numerical optimization with ... exergoeconomic analysis of the system at each iteration and on several qualitative and quantitative objective criteria, a hierarchical classification of the system components, and the associated subsets...
- 14
- 593
- 0
Tài liệu Activity 4.2: Creating a Logical Data Model ppt
... actions that define the relationship between each pair of entities, and label the line with the relationship verb This is the initial ER diagram for the logical data model Answer in v04_160 9a_ act42-1.bmp ... cardinality and existence characteristics of each of the relationships defined in Exercise ! Identify cardinality For each relationship on your ER diagram, ask the question “How many of the parent ... v04_160 9a_ act42-1.bmp Activity 4.2: Creating a Logical Data Model Exercise 2: Determining Cardinality and Existence In this exercise, you will use the syntax discussed in the module to identify the cardinality...
- 4
- 409
- 0
Báo cáo khoa học: "Towards A Modular Data Model For Multi-Layer Annotated Corpora" docx
... specifies a data model and serialization format for XML, a semantics is largely left to be defined for a particular application Many data models can be mapped to the XML data model and serialized to ... annotation data in XML from any source as separate annotation layers, provided the text nodes in each layer contain the same base data The base data is extracted and kept in a text file and the annotation ... relation it models Pointers allow an element to have multiple parents and to refer to other elements across annotation layers Features have a name and a value They are always bound to an annotation...
- 8
- 337
- 0
báo cáo hóa học:" Caveolin-1 enhances resveratrol-mediated cytotoxicity and transport in a hepatocellular carcinoma model" docx
... a microtome After de-paraffinization, rehydration and antigen recovery, tissue sections were examined for expression of CAV1 and Topoisomerase-alpha proteins by CAV1 and Topoisomerase-alpha antibody ... has greater anticancer and cardio-protective properties than the cis-isomer As an estrogen analog activating ERα and ERβ, RES was suggested as a candidate chemo-preventive agent and a treatment ... p38MAPK cascade pathway and promotes the activation of the pre-apoptotic protein caspase-3 of proliferation and induction of HepG2 cell apoptosis mediated through the p38MAPK pathway and caspase-3...
- 13
- 714
- 0
Báo cáo sinh học: "Breeding value prediction for production traits in layer chickens using pedigree or genomic relationships in a reduced animal model" docx
... selection at a later age than at an early age, when data on sibs of selection candidates were available (Figures and 2) This extra information increased the accuracy of all methods and particularly of ... trait and comparing the average hatch-corrected phenotype of the selected individuals Marker based parental average (PA) EBV were also calculated for animals in the validation sets to evaluate ... Table Statistical analysis Because of the data structure, a reduced animal model was applied with all parents genotyped and many nongenotyped non-parent progeny with phenotypes In this approach,...
- 9
- 477
- 0
Tài liệu Báo cáo khoa học: Four divergent Arabidopsis ethylene-responsive element-binding factor domains bind to a target DNA motif with a universal CG step core recognition and different flanking bases preference pptx
... DNA-binding site A 60 bp single-stranded DNA RDM10, with 10 randomized oligonucleotides in the center, i.e CTGTCAGTGAT GCATATGAACGAATN10AATCAACGACATTAGGATC CTTAGC was synthesized A 100 ng sample ... of a three-stranded antiparallel b-sheet and an a- helix, packed approximately parallel to the b-sheet, with the seven thoroughly conserved amino acids (Arg6, Arg8, Trp10, Glu16, Arg18, Arg26 and ... Industrial Science and Technology, MITI, Japan, and of an STA fellowship from the Science and Technology Agency of Japan This study was also supported partially by a grant issued by the National Natural...
- 10
- 464
- 1
Tài liệu Báo cáo khoa học: PC1⁄3, PC2 and PC5⁄6A are targeted to dense core secretory granules by a common mechanism doc
... J D Dikeakos et al is autocatalytically cleaved, a central catalytic domain comprising the catalytic triad of amino acids aspartic acid, histidine and serine, and a stabilizing P-domain involved ... …ATEESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG and granule-containing cytoplasmic extensions (ACTH) Thus, the C-terminal domains of PC1 ⁄ 3, PC2 and PC5 ⁄ 6A are all equally capable of redirecting a constitutively secreted protein to granule-containing ... h at room temperature Slides were mounted using a SlowFade Light Antifade Kit (Molecular Probes) and visualized using a Zeiss LSM 510 Confocal Microscope (Carl Zeiss Canada Ltd., Toronto, Canada)...
- 9
- 600
- 0
Báo cáo y học: "Leveraging a clinical research information system to assist biospecimen data and workflow management: a hybrid approach" pptx
... barcode labels record standard information such as patient ID, event, sample type and aliquot number The samples are batch shipped and aliquots that are received are scanned at the data and sample ... Interfaces for Clinical Data User interfaces for interactive data capture must support robust validation and ergonomics Parameter-level validation includes data type, range and set-membership, and ... spreadsheets Rather than force external labs to return data in a specific format, we accept their format and bulkimport data using a set of mapping tables that map columns in their data (patient...
- 8
- 477
- 0
Báo cáo y học: "Data from necropsy studies and in vitro tissue studies lead to a model for allometric scaling of basal metabolic rate" pot
... 399:130-132 Banavar JR, Damuth J, Maritan A, Rinaldo A: Supply-demand balance and metabolic scaling Proc Natl Acad Sci USA 2002, 99:10506-10509 Darveau C -A, Suarez RK, Andrews RD, Hochachka PW: Allometric ... and (6) are used to predict log(BMR) The two-parameter model of Equation (4) and the three-parameter model of Equation (7) fit the data approximately equally well, and these models fit the data ... bone mass is 1.09 [26], and an average of MLEs of the scaling exponent for brain mass is 0.73 [27] The anatomical conceptualization has also been used to develop a five-compartment anatomical model...
- 8
- 356
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25