a crystal structure of ru l11 2 pf6 4·4 5 c2h5 2o·2ch3cn
Metal Complexes of 4′-Substituted-2,2′:6′,2″-Terpyridines in Supramolecular Chemistry
... )2] [PF6 ]2 300 and 14 304 Appendix IV: Crystal data of L and 2, 7-di (2- hydroxyethoxy)naphthalene 306 Appendix V: Crystal data of [ {Ru( L11) }2] [PF6 ]2 4 5( C2H5) 2O·2CH3CN, [{Fe(L14)}] [PF6 ]2 (C2H5) 2O·½CH3CN ... elecrospray ionisation mass spectrometric characterisation 24 6 7.3 Absorption spectroscopic characterisation 26 5 7.4 Crystal structures of [ {Ru( L11) }2] [PF6 ]2 4 5( C2H5) 2O·2CH3CN, 14 [{Fe(L )}] [PF6 ]2 (C2H5) 2O·½CH3CN ... Appendix I: Appendix II: Appendix III: Crystal data of L2 and [HL9]+Cl-·H2O 29 8 Crystal data of [M(L )] [PF6 ]2 CH3CN and [M(L )2] [PF6 ]2 (where M = Fe and Ru) Crystal data of [Co(L8 )2] [PF6 ]2 1¾CH3CN...
- 341
- 258
- 0
Tài liệu Báo cáo khoa học: The crystal structure of human a-amino-b-carboxymuconatee-semialdehyde decarboxylase in complex with 1,3-dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis ppt
... human 6 622 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 a- amino-b-carboxymuconate-e-semialdehyde decarboxylase (ACMSD) J Biol Chem 27 7, 351 62 351 67 Tanabe A, Egashira Y, Fukuoka SI, Shibata K ... a- amino-b-carboxymuconate-e-semialdehyde decarboxylase J Am Chem Soc 129 , 927 8– 927 9 Fukuoka SI, Ishiguro K, Yanagihara K, Tanabe A, Egashira Y, Sanada H & Shibata K (20 02) Identification and expression of a cDNA ... rmsd bond angles (°) ˚ Mean B-factor protein (A2 ) ˚ Mean B-factor solvent (A2 ) ˚ Mean B-factor DHAP ⁄ Zn (A2 ) ˚ Mean B-factor glycerol atoms (A2 ) 26 35 21 6 10 ⁄ 19.3 25 .6 0.018 1.6 15. 3 25 .2 39.3...
- 9
- 796
- 0
Tài liệu Báo cáo khoa học: The crystal structure of coenzyme B12-dependent glycerol dehydratase in complex with cobalamin and propane-1,2-diol pptx
... Shibata, N., Morimoto, Y., Toraya, T & Yasuoka, N (20 00) How a protein generates a catalytic radical from Ó FEBS 20 02 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 Structure of B 12- dependent ... dehydratase a subunit was amplified by PCR using pUSI2E(GD) [28 ], pfu DNA polymerase (Stratagene) and pairs of primers 5 -TCTGAGTGCGGTGGAAGAGATG ATGAAGCG-3¢ and 5 -AGATCTTATTCAATGGTGT CGGGCTGAACC-3¢ ... pUSI2E(aG) DNA segments encoding the b and c subunits of glycerol dehydratase were amplified by PCR using pairs of primers 5 -CATATGCAACAGACAACCCAAATTCAGCCC-3¢ and 5 -AGATCTTATCACTCCCTTACTAAGTCGATG-3¢...
- 11
- 602
- 0
Báo cáo khoa học: Crystal structure of basic 7S globulin, a xyloglucanspecific endo-b-1,4-glucanase inhibitor protein-like protein from soybean lacking inhibitory activity against endo-b-glucanase doc
... Generously allowed (%) Disallowed (%) ˚ Averaged B-value (A2 ) PDB code 1.0000 P2 121 2 1 35 .2 161 .2 84.8 50 .0–1.90 720 55 4 138 56 8 6 .5 (36 .5) 95. 6 (81.0) 11.3 (1.9) 20 –1.91 130 634 65 32 11 29 7 621 21 .1 25 .9 ... The DASA of the AB dimer is defined as [(ASA of A) + (ASA of B) ) (ASA of AB dimer)] ⁄ The number of water molecules in the dimer interface was detected with ASV CALCULATOR [34] ASA was calculated ... Yamauchi F, Sato K & Yamagishi T (1984) Isolation and partial characterization of a salt extractable globulin from soybean seeds Agric Biol Chem 48, 6 45 650 Hanada K, Nishiuchi Y & Hirano H (20 03)...
- 11
- 524
- 0
Báo cáo khoa học: The crystal structure of a xyloglucan-specific endo-b-1,4glucanase from Geotrichum sp. M128 xyloglucanase reveals a key amino acid residue for substrate specificity potx
... programs for protein crystallography Acta Crystallogr D 50 , 760–763 18 Navaza J (1994) AMoRe: an automated package for molecular replacement Acta Crystallogr A 50 , 157 –163 19 Brunger AT, Adams ... Acta Crystallogr D 54 , 9 05 921 20 Brunger AT (19 92) Free R-value – a novel statistical ¨ quantity for assessing the accuracy of crystal structures Nature 355 , 4 72 4 75 21 Emsley P & Cowtan K (20 04) ... refinement against the 20 2. 5 A intensity data A randomly selected portion of the diffraction data (5. 0%) was used to calculate the free R factor [20 ] The program coot [21 ] was used to display and correct...
- 7
- 361
- 0
Báo cáo khoa học: Crystal structure of a cold-adapted class C b-lactamase potx
... Asp108–Arg1 05 Asp1 85 Lys183 Glu196–Arg210 Glu300–Arg1 05 Glu2 72 Arg148 21 19 14 0 92 824 8 58 44 –1 6 .5 No of hydrogen bonds (side chain–side chain) Aromatic stacking ˚ ASA total (A2 ) ˚ ASA apolar (A2 ) ˚ ASA ... Asp103–Arg107 Asp 251 –Lys 258 Asp283–His271 Glu366–His370 Glu287–Arg163 15 16 3. 15 5 .2 1.67 33 7.3 (28 ) 8.1 1 .5 376 11 Glu5–His39 Glu1 95 His186 Glu1 95 His198 Glu 358 –His 355 Asp76–Arg80 Glu 82 Arg177 Asp108–Arg1 05 ... J (20 03) The structure of a cold-adapted family xylanase at 1.3 A resolution Structural adaptations to cold and investgation of the active site J Biol Chem 27 8, 753 1– 753 9 22 Georlette D, Damien...
- 11
- 341
- 0
Crystal structure of arabidopsis thaliana cyclophilin 38 (atcyp38 2
... in AtCyP38 are: Arg290, Phe294, Gln297, Gly307, Ala 358 , Ala360, Gln3 72, Phe374 and Leu3 82, which correspond to Arg 55, Phe60, Gln63, Gly 72, Ala101, Ala103, Gln111, Phe113 and Leu 122 of hCyPA Of ... present in the crystal and no part of it has got cleaved off during the crystallization process 4 .5 .2 Data collection and analysis The native and selenomethionylated crystal data sets for all the five ... and MAD data collection at the NSLS synchrotron was planned for MALDI-TOF mass spectrometric analysis of the crystals gave a mass of 40470 .24 + 1.06 for the native multiple mutant and 411 02. 15 +...
- 36
- 182
- 0
Structural basis of protein stability at poly extreme crystal structure of amya at 1 6 a resolution 2
... Interacting Atoms ASP 44 OD1 ASP 46 OD1 ASP 48 OD1 ILE 50 O ASP 52 OD2 WAT 27 Distance in Å 2. 47 2. 49 2. 50 2. 45 2. 48 2. 70 Calcium No Interacting Atoms ASP 65 OD1 ASP 67 O THR 70 O THR 70 OG1 ASP ... 51 5 Thermus Sp pI Asp/Glu Surface charge Arg/Lys His Out In Out In Out In Out In 5. 34 +0 .5 -8 .5 48 23 45 11 7 58 8 5. 52 -7 .5 -0 .5 66 19 51 15 15 Thermoactinomyces Vulgaris R- 47 58 5 5. 52 +5. 5 ... entire salinity range (Fig 2. 10) The activity profiles of AmyA at different temperatures and pH are shown in Figs 2. 11 and 2. 12 Figure 2. 13 AmyA activity profile Activity assay of AmyA using 20 mM...
- 33
- 290
- 0
Tài liệu Báo cáo khoa học: Crystal structure of an ascomycete fungal laccase from Thielavia arenaria – common structural features of asco-laccases ppt
... Journal 27 8 (20 11) 22 83 22 95 ª 20 11 The Authors Journal compilation ª 20 11 FEBS 22 85 Crystal structure of a Thielavia arenaria laccase J P Kallio et al thermostability of the enzyme [34] On the basis ... Journal compilation ª 20 11 FEBS 22 93 Crystal structure of a Thielavia arenaria laccase J P Kallio et al 15 Lyashenko AV, Zhukova Y, Zhukhlistova N, Zaitsev V, Stepanova E, Kachalova G, Koroleva ... biology: structure of a metallo-oxidase Fet3p Proc Natl Acad Sci USA 1 02, 154 59– 154 64 Smith AW, Camara-Artigas A, Wang M, Allen JP & Francisco WA (20 06) Structure of phenoxazinone synthase from...
- 13
- 888
- 0
Tài liệu Báo cáo khoa học: Crystal structure of importin-a bound to a peptide bearing the nuclear localisation signal from chloride intracellular channel protein 4 ppt
... Side chain Main chain Side chain Total Buried surface ˚ area (A2 ) RSCCc Val201 Ala2 02 P2 Lys203 P3 Lys204 P4 Tyr2 05 P5 Arg206 P6 Asn207 Totals 0⁄1⁄0 1⁄8⁄0 0⁄6⁄1 3 5 0 0⁄8⁄0 3⁄9⁄0 0⁄6⁄3 ⁄ 42 ⁄ 0⁄0⁄0 ... macromolecular crystallography beamlines J Synchrotron Radiat 9, 401–406 35 Leslie AG (20 06) The integration of macromolecular diffraction data Acta Crystallogr D: Biol Crystallogr 62, 48 57 36 Collaborative ... eiac where the phases (aapo ) are obtained from the apo imporc tin -a structure FEBS Journal 27 8 (20 11) 16 62 16 75 ª 20 11 The Authors Journal compilation ª 20 11 FEBS A V Mynott et al Crystal structure...
- 14
- 741
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 – insights into the enzyme mechanism and stability pdf
... The Authors Journal compilation ª 20 10 FEBS 607 Crystal structure of SOD from A pernix K1 17 18 19 20 21 22 23 24 25 26 27 608 T Nakamura et al philic archaeon, Aeropyrum pernix J Biochem 126 , 21 8 22 5 ... Journal 27 8 (20 11) 59 8–609 ª 20 10 The Authors Journal compilation ª 20 10 FEBS T Nakamura et al Crystal structure of SOD from A pernix K1 A B 90° Fig Crystal structure of ApeSOD (A) Monomer structures ... (23 .9) ⁄ 20 .3 ( 25 .4) 0.008 1.170 6 823 18 734 49. 75 1.48 (1. 52 1.48) 11 353 9 (79 65) 22 .6 (29 .5) ⁄ 25 .6 ( 32. 7) 0.0 12 1.3 82 6 855 10 417 24 .5 39.1 14.8 27 .6 10.1 21 .0 28 .4 16.0 91.8 8.0 92. 9 7.1 92. 2...
- 12
- 762
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc
... Crystal structure of Klebsiella phytase PhyK A Tyr249 Thr2 92 K Bohm et al ¨ Tyr249 Thr2 92 Asp291 Asp291 Arg24 Arg24 Asn209 His290 Arg100 Asn209 Arg100 Arg28 Arg28 Thr31 B Thr31 C Fig Schematic ... H2 5A 0.8984 94 .5 1. 65 1. 75 1. 65 P4 321 2 100 MAR IP 3 45 0.8100 50 .0 2. 57 2. 65 2. 57 P2 121 21 110 Mar CCD 1 65 mm 133.69 133.69 111 .24 644 348 5. 7 15. 0 (2. 60) 94.1 ( 72. 9) 6.9 (40.9) 81.71 122 .93 20 5. 40 ... modification Acta Crystallogr D 56 , 9 65 9 72 29 Perrakis A, Harkiolaki M, Wilson KS & Lamzin VS (20 01) ARP ⁄ wARP and molecular replacement Acta Crystallogr D 57 , 14 45 1 450 30 Murshudov GN, Vagin AA & Dodson...
- 13
- 766
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx
... Kataoka H, Uchino H, Asada Y, Hatakeyama K, Nabeshima K, Sumiyoshi A & Koono M (1997) Analy- Crystal structure of the catalytic domain of DESC1 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 sis of ... al Crystal structure of the catalytic domain of DESC1 Fig Structure- based sequence alignment of the human DESC1 catalytic domain with human DESC2 [2] , human DESC3 [2] , HAT, HAT-like [6], human ... (°) P2 121 2 a ¼ 47.9 b ¼ 70 .2 c ¼ 80 .2 a ¼ b ¼ c ¼ 90° 1 .54 20 –1.6 98.1 (89.8) 0.079 (0.186) 4.6 (2. 1) 20 –1.6 1930 130 21 .13 (24 .3) 22 .14 (26 .4) 29 853 ⁄ 155 6 28 .39 0.0 054 15 1.36707 Crystallographic...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc
... families database Nucleic Acids Res 30, 27 6 28 0 Handa N, Terada T, Kamewari Y, Hamana H, Tame JRH, Park S-Y, Kinoshita K, Ota M, Nakamura H, Kuramitsu S et al (20 03) Crystal structure of the conserved ... types of GAB catalysis have been identified to date [ 12] which are based either on a single, bifunctional GAB catalyst or on a GAB catalysts pair The available biochemical data on MshB and LpxC are ... method Acta Crystallogr D 53 , 24 0 25 5 Kabsch W (1976) A solution for the best rotation to relate two sets of vectors Acta Crystallogr A 32, 922 – 923 Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat...
- 11
- 710
- 0
Tài liệu Báo cáo khoa học: ˚ The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species docx
... atoms of Asp11 and Asn23 (Fig 3) in an arrangement similar to what is observed in VPRK Both PRK and VPRK have calcium bound at Ca3 SPRK also has an aspartic acid residue at position at 20 0, and ... the same conformation as in the two other structures, but Asp200 forms a salt bridge to Lys 253 (Ala 253 and Asn 250 in PRK and VPRK, respectively), and probably loses some of its potential as calcium ... methoxysuccinyl-Ala-Ala-Pro-Ala-chloro˚ methyl ketone: an x-ray study at 2. 2 -A resolution J Biol Chem 26 6, 176 95 17699 FEBS Journal 27 3 (20 06) 61–71 ª 20 05 The Authors Journal compilation ª 20 05 FEBS R Helland...
- 11
- 551
- 0
Tài liệu Báo cáo khoa học: Crystal structure of a subtilisin-like serine proteinase from a psychrotrophic Vibrio species reveals structural aspects of cold adaptation docx
... E28–K 95 D 124 –K 153 D188–R270 D201–R249 E 253 –R249 D 257 –R270 D 257 –K2 75 2. 97 3.00 3.91 2. 79 3 .20 2. 81 3.41 2. 98 2. 80 2. 78 ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A a The criterion of conserved ion pairs ... D187–R 12 (E27–87 E48–R80 E50–R 52 D98–K94 D1 12 R147 D117–R 121 D184–R188 D260–R 12 1THM 2. 77 4. 65 3.93 2. 95 2. 75 2. 76 2. 94 3. 02 3. 02 ˚ A ˚ A) a ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A D57–R1 02 D60–R1 02 D188–K17 E28–K 95 ... compared enzymes are underlined 1SH7 1IC6 D56–R 95 D59–R 95 D183–R10 ˚ 2. 99 A ˚ 3.03 A ˚ 2. 74 A D138–R169 E236–R2 52 E 255 –K267 D260–R1 85 D274–R14 3. 02 2.83 2. 81 2. 92 3 .28 ˚ A ˚ A ˚ A ˚ A ˚ A D187–R12...
- 14
- 597
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase complexed with an analogue of 1,3-bisphospho-D-glyceric acid Selective inhibition by structure-based design docx
... oligonucleotides: a sense primer 5 -CAACAAATTTGCATATGACTATT AAAG-3¢ containing an NdeI site (underlined) next to the start codon of the T brucei gGAPDH gene; an antisense primer 5 -CAGCCAAGCGCCTAGGGAGCGAGA AC-3¢, ... Processing of X-ray diffraction data collected in oscillation mode Methods Enzymol 27 6, 307– 326 Navaza, J (1994) AMoRe: an automated package for molecular replacement Acta Crystallogr A 50 , 157 –163 Brunger, ... 85 ± 15 95 ± 100 ± 10 100 ± 13 23 5 ± 22 800 ± 90 70 ± 160 ± 90 2. 6 ± 0 .2 250 ± 20 10.7 ± 0.3 150 ± 20 50 ± 0 .5 23 5 ± 18 4.4 ± 0.3 51 5 ± 24 0 .2 ± 0. 05 Enzymatic inactivation studies were carried...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of thiamindiphosphate-dependent indolepyruvate decarboxylase from Enterobacter cloacae, an enzyme involved in the biosynthesis of the plant hormone indole-3-acetic acid doc
... Enterobacter cloacae Biochim Biophsy Acta 120 9, 24 1 24 7 Koga, J., Adachi, T & Hidaka, H (19 92) Purification and characterization of indolepyruvate decarboxylase J Biol Chem 26 7, 15 823 – 15 828 Sekimoto, ... relationships of indolepyruvate decarboxylase from Enterobacter cloacae, a key enzyme of the indole acetic acid pathway Eur J Biochem 27 0, 23 22 23 31 Arjunan, P., Umland, T., Dyda, F., Swaminathan, ... determination Acta Crystallogr D54, 9 05 921 Brunger, A. T (1993) Assessment of phase accuracy by cross validation: the free R value Methods and applications Acta Crystallogr D49, 24 –36 Jones, T .A. ,...
- 10
- 557
- 0
Báo cáo khoa học: Crystal structure of salt-tolerant glutaminase from Micrococcus luteus K-3 in the presence and absence of its product L-glutamate and its activator Tris pdf
... 3if5) There are disordered regions in the F ( 354 -403 and 449 456 aa), N ( 354 -376, 3 95- 401 and 446- 456 aa), G ( 353 - 359 , 397-4 02 and 449- 456 aa), T (449- 456 aa) and TG ( 451 - 456 aa) structures Fig Active ... l-glutamate in an extended form ˚ (Fig 7A) with a contact area of 28 8 A2 Asparaginase binds l-glutamate in a folded form (Fig 7B) in an apparently much smaller pocket with a contact area of ˚ 23 3 A2 ... glutaminase A B Fig L-Glutamate in complex with Mglu and asparaginase of Erwinia carotovora LGlutamate (cylinder) on the surfaces of the structures of TG (A) and asparaginase of E carotovora (B)...
- 11
- 521
- 0
Báo cáo khoa học: The crystal structure of NlpI A prokaryotic tetratricopeptide repeat protein with a globular fold potx
... were 5 -aataatccatggggagtaatacttcctggcgta aaagtgaagtcc-3¢ and 5 -attattggatccctattgctggtccgattctgccag-3¢ 3-TPR NlpI primers (residues 62 197) were 5 -aataatccatgg gggcacagcttttatatgagcgcggag-3¢ and ... 2. 5 Helix 11 21 2, 21 6 16 Helix 12 237, 24 0, 24 4 Helix 13 25 5, 25 8, 25 9 ,26 1, 26 2, 26 4, 26 6 16 Helix 14 27 1, 27 5, 27 8 2. 45 Total 38 FEBS Journal 27 2 (20 05) 166–179 ª 20 04 FEBS C G M Wilson et al ... Y A F A P DDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDM 96–108 1 12 1 25 5. 9 5. 1 (TPR2) )1 65. 5 +16.7 59 .0 (pair 2 3) PEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY 131–1 42 146– 159 8.9 12. 2 (TPR3) ) 153 .0 +26 .5 16.2...
- 14
- 433
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25