... on plasma membrane regulates T cell adhesion J Cell Biol 164, 461–470 Fujita H, Fukuhara S, Sakurai A, Yamagishi A, Kamioka Y, Nakaoka Y, Masuda M & Mochizuki N (2005) Local activation of Rap1 ... Beraud-Dufour et al participates in an integrin activation complex that binds to and activates b integrins [5] VAV1 and TIAM1 are localized by Rap1GTP to sites of cell spreading and serve as ... Acta 858, 161–168 Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W & Lipman DJ (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs Nucleic Acids...
... [8] After an infected tick bite, ulceroglandular tularaemia is the most common presentation of the disease [9] Ulceroglandular disease accounts for 60 to 80% of tularaemia cases; affected patients ... eschar and lymphadenopathy decreased after two weeks of treatment Discussion F tularensis is the causative agent of tularemia, a bacterial zoonotic disease of the northern hemisphere A wide range ... and women during colder seasons, and it is associated with R slovaca, R raoultii, B henselae, B burgdorferi and perhaps F tularensis [6] However, the spectrum of causative agents of SENLAT was...
... ΔΨm 5’-RACE β2m mitochondrial membrane potential 5' -rapid amplification of cDNA ends β2-microglobulin aa AAH AFP ALAS ANOVA ATP amino acid atypical adenomatous hyperplasia α-fetoprotein δ-aminolevulinate ... Shimosato Y Early stages of multistep hepatocarcinogenesis: adenomatous hyperplasia and early hepatocellular carcinoma Hum Pathol 1991;22:172-178 48 Nakanuma Y, Terada T, Ueda K, Terasaki S, ... 62 Ando E, Tanaka M, Yamashita F, Kuromatsu R, Takada A, et al Diagnostic clues for recurrent hepatocellular carcinoma: comparison of tumour markers and imaging studies Eur J Gastroenterol Hepatol...
... Connectionist, Statistical and Symbolic Approaches to Learning/or Natural Language Processing, pages 425-438, Springer J Klavans, C Jacquemin, and E Tzoukermann 1997 A natural language approach to multi-word ... candidate terms 2.1 Semantic variation and synonymy relation Semantic variation The semantic variation includes relations (e.g synonymy and see-also) between words of the same grammatical category, ... notable (notable deterioration) fausse manoeuvre (wrong operation) action de l'op~rateur (action of the operator) capacit~ interne (internal capacity) capacit~ totale (total capacity) capacit~...
... 5¢-GGACGATGCCACCAGTACTCTG GATGCTGGCAACC-3¢ and 5¢-GGTTGCCAGCATCC AGAGTACTGGTGGCATCGTCC-3¢ and for TAP2 the complementary primers 5¢-GGATGAGGCTACCAGTAC TCTGGACGCCGAGTGCG-3¢ and 5¢-CGCACTCGGC GTCCAGAGTACTGGTAGCCTCATCC-3¢ ... binding by TAP Eur J Immunol 33, 422–427 Matsuoka, T., Matsushita, K., Katayama, Y., Fujita, A. , Inageda, K., Tanemoto, M., Inanobe, A. , Yamashita, S., Matsuzawa, Y & Kurachi, Y (2000) C-terminal tails ... of anti-TAP1 and anti-TAP2 serum TAP variants are indicated by pictograms (B) The results of the ATP cross-link experiment were quantified by phosphoimager Peak integrals of TAP1- and TAP2-ATP...
... by PCR from total DNA using the primers pADm1 (forward; 5¢-AGCAGTCGACGA AGCGACGAAGTGAAGCTGCGTGA-3¢) and pADm3 (reverse; 5¢-ATCCGTCGACATGCTTTTTAACTGTT CG-3¢) After digestion with SalI (which recognizes ... 365–377 Biswas, G., Adebanjo, O .A. , Freedman, B.D., Anandatheerthavarada, H.K., Vijayasarathy, C., Zaidi, M., Kotlikoff, M & Avadhani, N.G (1999) Retrograde Ca2+ signaling in C2C12 skeletal myocytes ... essential for promoter activity is boxed, and the GAGA and Adf-1 elements in the DNA are underlined The translation start codon and the main transcription start point are larger and in bold (B) Mutations...
... namely, MAPK kinase kinase (MAP3K), MAPK kinase (MAP2K), and MAPK The extracellular signals are mediated intracellularly as an activation of MAP3K that further activates MAP2K by phosphorylating ... 5¢-GGGTTGTGTACTCCATCTGCCCCAGAGTC TCCTGGG-3¢; 1 9A, 5¢-CTACCCCAGAGGCTCCTGG GAG-3¢; 58 A, 5¢-GCACATTTCCACCTGCACCTGCT AAAACTCCC-3¢; 1 3A1 9A, 5¢-GCGAGGGTTGTGTG CTCCATCTACCCCAGAGGCTCCTGGG-3¢; 13E19E, 5¢-CACCACCTATGCGAGGGTTGTGTGAGCCATC ... the pESP vector (Stratagene); sense, 5¢-GTACTTGAAATCCAGCAAGT ATATAGC-3¢; antisense, 5¢-CAAAATCGTAATATGCA GCTTGAATGGGCTTCC-3¢ The selected positive colony was grown in yeast extract plus supplements...
... Hybridization signals obtained, respectively, for pen- 3a transcripts and 18 S rRNA probes were quantified by STORM and analysed separately Data analysis revealed an important individual variation ... Scientific) and stored at )20 °C until use Phagocytosis assay MATERIALS AND METHODS Animals and immune challenge Juvenile shrimp (8–10 g) P vannamei (Crustacea, Decapoda) in intermoult stage were obtained ... postinjection (Fig 7A) Relative penaeidin mRNA levels dramatically decreased in all the tissues analysed and 12 h after microbial challenge, and increased thereafter in gills and midgut, at 48 or 72...
... Miyazaki, Y., Osaki, M., Shindo, H & Yamashita, S (2000) Activation of specific MEKERK cascade is necessary for TGF beta signaling and crosstalk with PKA and PKC pathways in cultured rat articular ... mitogen-activated protein kinase pathway Proc Natl Acad Sci USA 97, 1113–1118 Yonekura, A. , Osaki, M., Hirota, Y., Tsukazaki, T., Miyazaki, Y., Matsumoto, T., Ohtsuru, A. , Namba, H., Shindo, H & Yamashita, ... specified, all experiments were repeated at least twice, with similar results One-way analysis of variance (ANOVA ) was used for statistical evaluation Statistical analysis was performed by the Dunnett...
... QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN R3E 119 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGS PP1 ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLF RAT R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF HUMAN R3E 178 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLF GM/ RGL/R 3A ... gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 I H F I * 279 921 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig (A) Diagram of human PPP1R3E mRNA compared with PPP1R3E...
... Eason DB, Cantwell G: Characterization of homoepitaxial p-type ZnO grown by molecular beam epitaxy Appl Phys Lett 2002, 81:1830-1832 Masuda S, Kitamura K, Okumura Y, Miyatake S, Tabata H, Kawai ... Cebulla R, Wendt R, Ellmer K: Al-doped zinc oxide films deposited by simultaneous rf and dc excitation of a magnetron plasma: relationships between plasma parameters and structural and electrical ... as: Pedersen et al.: Direct Synthesis and Characterization of Optically Transparent Conformal Zinc Oxide Nanocrystalline Thin Films byRapid Thermal Plasma CVD Nanoscale Research Letters 2011...
... genes annotated in the database and to improve the annotation features and abilities of the database The rate limiting step for input of data into the database is the manual reading of papers by annotators ... maintenance and updating of database functions and contributed to writing the manuscript DHL wrote the PHP and perl scripts to annotate and populate the database and worked on database and table ... functions: 1) to act as a clearing house and storage database for all genes known from the primary literature to be regulatedby NFI transcription factors, 2) to allow rapid analysis and display of defined...
... storage proteins and genes related to amino acid and carbohydrate metabolism, and ABA-induced hormone related genes, calculated by Fisher’s exact test with a P-value cut off 0.01 (Figure and Additional ... Contig11522_at: chloroplast-targeted beta-amylase GBS3125: Contig3952_at: alpha-amylase Sucrose synthase II H1 T T T C AAAA C C A G G G 11 H2 T T C C AAAA T C A G G G H3 T T T C T G AA T C T G AA ... H4 T T T C AAAA T C T G AA H5 T T T C AA G C C C A G AA H6 C G T AAA G C C C T AAA H7 T T T C AAAA T T T G AA Σ 29 Figure The expression profiles of a selection of starch biosynthesis/degradation...
... pulmonary and airway inflammation and fibrosis Proc Am Thorac Soc 2006, 3(5):413-417 Togo N, Ohwada S, Sakurai S, Toya H, Sakamoto I, Yamada T, et al.: Prognostic significance of BMP and activin ... area: isotype control) AM = alveolar macrophages n = and ISH and was confirmed by RT-PCR and sequencing Using IHC on isolated AMs a typical membrane-bound pattern is demonstrated (figure 5a and ... USA) Bronchoscopy and isolation of BAL cells Bronchoscopically guided lavage and isolation of AM was performed as described previously [20] Statistical analysis Data are presented as the mean...
... Sigma-Aldrich, St Louis, MO) or CSO alone (20 μl) via intraperitoneal (IP) injection daily from PN3-14; (3) DEX and RA at doses and days as above; (4) saline and CSO at doses and days above; and ... may, therefore, serve as a paracrine signal that originates in the epithelium, targets pulmonary vascular cells and influences lung vascularization during the alveolar and microvascular maturation ... measured using the eukaryote total RNA nano assay on an Agilent 2100 bioanalyzer (Agilent, Palo Alto, CA) Integrity was also confirmed using 1% agarose gels Reverse Transcription and Quantitative...
... breast cancers? Invasion Metastasis 1994, 14:329-336 Rhodes DR, Yu J, Shanker K, Deshpande N, Varambally R, Ghosh D, Barrette T, Pandey A, Chinnaiyan AM: ONCOMINE: a cancer microarray database and ... and specificity of the separate DNA microarray platforms used We might expect the cluster Aand E genes from our in vitro data (Figure 1a) to have less agreement with the xenograft data compared ... Acknowledgements This work was supported in part by Breast Cancer Research Foundation grant N003173 References 10 11 12 13 14 15 16 Additional data files The following additional data are available...
... Journal of Water and Environment Technology, Vol.3, No.2, 2005 fields and forests on a plateau anda wetland which includes a paddy field in the lowlands Initial investigation showed that certain ... Outflow Diagram in a Small Agricultural Area Having Uplands and Lowlands Trans JSIDRE 154,65-72.(in Japanese) Tabuchi T., (1998), Nitrogen Outflow Model with Nitrogen Removal Function by Paddy Fields, ... understood that the amount of load decreases as it passes through the lowlands A wetland has a natural purification function for nitrogen and is therefore considered important in the curtailment of...