1. Trang chủ
  2. » Luận Văn - Báo Cáo

Tách dòng và biểu hiện gen VP1 của Enterovirus 71

67 59 0

Đang tải... (xem toàn văn)

Tài liệu hạn chế xem trước, để xem đầy đủ mời bạn chọn Tải xuống

THÔNG TIN TÀI LIỆU

Thông tin cơ bản

Định dạng
Số trang 67
Dung lượng 1,44 MB
File đính kèm 123.rar (12 MB)

Nội dung

ĐẠI HỌC QUỐC GIA TP HCM TRƯỜNG ĐẠI HỌC BÁCH KHOA NGUYỄN DANH LÂM TÁCH DÒNG VÀ BIỂU HI ỆN GEN VP1 CỦA ENTEROVIRUS 71 Chuyên ngành : Công nghệ sinh học Mã số 60.42.02.01 LUẬN VĂN THẠC SĨ TP HỒ Chí Minh, tháng 12 năm 2015 CƠNG TRÌNH ĐƯỢC HỒN THÀNH TẠI VIỆN PASTEUR TP HỒ CHÍ MINH Cán hướng dẫn khoa học: PGS.TS CAO THỊ BẢO VÂN Cán chấm nhận xét 1: PGS.TS LÊ PHI NGA Cán chấm nhận xét 2: PGS.TS NGUYỄN THỦY HƯƠNG Luận văn thạc sĩ bảo vệ Trường Đại học Bách Khoa, ĐHQG Tp HCM ngày 08 tháng 01 năm 2016 Thành phần Hội đồng đánh giả luận thạc sĩ bao gồm: Chủ tịch: TS Hoàng Quốc Khánh Phản biện 1: PGS.TS Lê Phi Nga Phản biện 2: PGS.TS Nguyễn Thúy Hương ủy viên: TS Nguyễn Tú Anh Thư ký: TS Hoàng Mỹ Dung Xác nhận Chủ tịch Hội đồng đanh giá luận văn Trưởng Khoa quản lý chuyên ngành sau luận văn sửa chữa (nếu cố) CHỦ TỊCH HỘI ĐỒNG TRƯỞNG KHOA KTHH ĐẠI HỌC QUÓC GIA TP.HCM TRƯỜNG ĐẠI HỌC BÁCH KHOA CỘNG HÒA XÃ HỘI CHỦ NGHĨA VIỆT NAM Độc lập - Tự - Hạnh phúc NHIỆM VỤ LUẬN VĂN THẠC SĨ Họ tên học viên: NGUYỄN DANH LÂM MSHV: 13310303 Ngày, tháng, năm sinh: 12/10/1983 Nơi sinh: Hà Nội Chuyên ngành: Công nghệ Sinh học Mã số : 60.42.02.01 l TÊN ĐỀ TÀI: Tách dòng biểu gen VP1 Enterovirus 71 II NHIỆM VỤ VÀ NỘI DUNG: - Tạo dòng gen VP1 EV71 hệ thống biểu pET SUMO - Tối ưu hóa biểu protein VP1 tế bào E.coli DE3 (E.coli BL21) - Tinh chế protein VP1 tái tổ hợp phương pháp sắc ký lực III NGÀY GIAO NHIỆM VỤ: 19/01/2015 IV NGÀY HOÀN THÀNH NHIỆM VỤ: 09/12/2015 V CÁN BỘ HƯỚNG DẪN: PGS.TS CAO THỊ BẢO VÂN Tp HCM, ngày tháng năm 20 CÁN BỘ HƯỚNG DẪN (Họ tên chữ ký) CHỦ NHIỆM BỘ MÔN ĐÀO TẠO (Họ tên chữ ký) TRƯỞNG KHOA KTHH (Họ tên chữ ký) -i- LỜI CẢM ƠN Với lòng biết ơn sâu sẳc em xin gửi lời cảm ơn chân thành tới PGS TS Cao Thị Bảo Vân, Trưởng phòng sinh học phân tử - Viện Pasteur Thành phố Hồ Chí Minh tận tình hướng dẫn, truyền thụ cho em kiến thức quý báu lòng nhiệt tình suốt trình hồn thành đề tài Em xin gửi lời cảm ơn đến tất quí thầy cô Ngành Công nghệ sinh học - Khoa Kỹ thuật Hóa học, trường Đại học Bách khoa Thành phố Hồ Chí Minh, cung cấp cho em kiến thức bổ ích suốt q trình học tập trường Xin cảm ơn anh, chị Phòng sinh học phân tử - Viện Pasteur Thành phố Hồ Chí Minh, đặc biệt anh Nguyễn Văn Khoa giúp đỡ rẩt nhiều chia sẻ kinh nghiêm để tơi hồn thành luận văn Xin cảm ơn Lãnh đạo Phân viện Khoa học Hình Thành phố Hồ Chí Minh tạo điều kiện thời gian tinh thần cho tơi hồn thành tốt chương trình học tập Cuối xin cảm ơn gia đình, người thân động viên, giúp đỡ suốt trình học tập TP.HCM, tháng 12 nãm 2015 Nguyễn Danh Lâm TÓM TẮT LUẬN VĂN Enterovirus 71 tác nhân gây bệnh Tay Chân Miệng có khả gây biến chứng thần kinh nghiêm trọng thường dẫn đến tử vong Để ngăn ngừa theo dõi truyền nhiễm biến đổi di truyền EV71 cần phải có phương pháp kịp thời hiệu Việc xác ên cứu bước đầu, thu số thành công định: - Đoạn gen VP1 phân lập từ chủng Enterovirus 71 phân nhóm C4 (VND11/202N2) nối thành cơng vào vector pET SUMO tạo vector tái tổ hợp pET SƯMO-VP1 Vector tái tổ hợp sau biến nạp nhân lên ửong tế bào E.coli Machl™ - T1R để bảo quản làm nguồn nguyên liệu cung cấp plasmid tái tổ hợp cho nghiên cứu biểu - Chúng biểu thành công protein VP1 tái tổ hợp tế bào E.coli DE3 (BL21) Protein tái tổ hợp biểu chủ yếu nằm dạng thể vùi Chúng khảo sát điều kiện biểu tìm điều kiện biểu tối ưu protein VP1 tái tổ hợp nồng độ IPTG tối ưu 0.6 mM thời điểm sau cảm ứng - Đã xây dựng quy trình tinh chế protein VP1 tái tổ hợp với hàm lượng độ tinh mong đợi Thể vùi hòa tan dung dịch chứa Na3PŨ4 0.02M, NaCl 0.5 M, Imidazole 0.015M Urea 8M Protein VP1 tái tổ hợp rửa giải khỏi cột Nikel dung dịch chứa Na3PŨ4 0.02M, NaCl 0.5 M, Imidazole 0.5M Urea 8M 5.2 Đề nghị Kết đạt thu protein VP1 có hoạt tính sinh học Do đó, chúng tơi đề nghị tiếp tục tái gấp cuộn thử nghiệm hoạt tính protein VP1 tái tổ hợp tiến tới ứng dụng sâu hom TÀI LIỆU THAM KHẢO Tài liệu tiếng Việt Bộ Y tế Hướng dẫn Chẩn đoán, điều trị bệnh tay-chân-miệng Ban hành kèm theo Quyết định số: 1732 /QĐ-BYT ngày 16 tháng năm 2008 Bộ trưởng Bộ Y tế Cao Đăng Nguyên, Đỗ Qúi Hải (2002), Công nghệ protein, Nhà xuất Đại học Huế N.T.H.Thanh., et al., (2010), Bệnh tay chân miệng người năm 2008 virus đường ruột 71 virus Coxsackie A16, Tạp chí Y học dự phòng, Tập XX số (114), tr: 46-52 Nguyễn Thanh Thủy, Trần Quang Huy Alas vi rút gây bệnh cho người Nhà xuất khoa Luận văn Thạc sỹ Kết luận đề nghị -51học tự nhiên công nghệ (2010) tr 190 PGS.TS Trần Đình Bình - Bộ mơn Vi sinh vật Y học, Trường Đại học Y Dược Huế Coxsackievirus bệnh tay chân miệng Thông tin khoa học 2011 Trần Ngọc Hữu 2012 Đặc điểm dịch tễ học bệnh tay chân miệng 20 tỉnh thành phía Nam Việt Nam, giai đoạn 2005-2011 Tạp chí ung thư học Việt Nam, số 1-2012 Tài liệu tiếng Anh Amersham Pharmacia biotech, pGEX vectors (GST Gene Fusion System), Third Edition, Rev 2, 18-1123-20 (http://www.amershambiosciences.com) Amersham, GST Gene Fusion System Handbook, Edition AA, 18-1157- 58 (http://www amershambiosciences com) Cardosa, M.J., et al., Molecular epidemiology of human enterovirus 71 strains and recent outbreaks in the Asia-Pacific region: comparative analysis of the VP1 and VP4 genes Emerg Infect Dis, 2003 9(4): p 461-8 10.Chan, Y.F and s AbuBaker, Recombinant human enterovirus 71 in hand, foot and mouth disease patients Emerg Infect Dis, 2004 10(8): p 1468-70 11.Chen, H.L., et al., Expression ofVPl protein in the milk of transgenic mice: a potential oral vaccine protects against enterovirus 71 infection Vaccine, 2008 26(23): p 2882-9 12.Chen, X., et al., A new baculovirus of cultured shrimps Sci China c Life Sci, 1997 40(6): p 630-5 13.De Jesus, N.H., Epidemics to eradication: the modem history of poliomyelitis Vhol J, 2007 4: p 70 14.Fernandez, J.M and J.p Hoeffler, Gene expression systems : using nature for the art of expressionl999, San Diego: Academic Press, xii, 480 p 15.Fikrig, E., et al., Protection of mice against the Lyme disease agent by immunizing with recombinant OspA Science, 1990 250(4980): p 553-6 16.1nvitrogen (2006, Ni-NTA purification system for purification of polyhistidine-containing recombinant proteins, User manual, Invitrogen corporation, USA 17.1nvitrogen 2010 Champion™ pET SUMO Protein Expression System For high-level expression and enhanced solubility of recombinant proteins in E coli and cleavage of native protein Catalog no K300-01 -5218.K.P Chan, KT Goh, c Y Chong, ES Teo, G Lau, A E Ling (2003), Epidemic hand, footh and mouth disease caused by human Enterovirus 71 Singapore, Emerg Infect Dis, 9, pp 78-85 19.Kaelin, W.G., Jr., et al., Expression cloning of a cDNA encoding a retinoblastoma-binding protein with E2F-like properties Cell, 1992 70(2): p 351-64 20.Ke, Y.Y., Y.c Chen, and T.H Lin, Structure of the virus capsid protein VP1 of enterovirus 71 predicted by some homology modeling and molecular docking studies J Comput Chem, 2006 27(13): p 1556-70 21.Kew, O.M., et al., Prolonged replication of a type vaccine-derived poliovirus in an immunodeficient patient J Clin Microbiol, 1998 36(10): p 2893-9 22 Lightner D.v (1996), a handbook of shrimp pathology and diagnostic procedures for for disease of cultured penaeid shrimp, World aquaculture Society, Baton Rouge, Lousiana, USA 23 McMinn, P.C., An overview of the evolution of enterovirus 71 and its clinical and public health significance FEMS Microbiol Rev, 2002 26(1): p 91- 107 24 Mierendorf R., Yeager K., Novy R (1994), “pET system: Your choice for expression’’, News letter of Novagen Inc., 1(1) 25 Nasri, D., et al., Basic rationale, current methods and future directions for molecular typing of human enterovirus Expert Rev Mol Diagn, 2007 7(4): p 419-34 26 New England Biolabs (2005), Tools for Protein Research, New England Biolabs Inc., Ipswich, USA 27 New England Biolabs, IMPACTTM I; One-Step protein purification system, Purification of recombinant by a self- cleavable affinity tag, version 1.8, New England Biolabs Inc., Ipswich, USA 28 Nilsson, J., et al., Affinity fusion strategies for detection, purification, and immobilization of recombinant proteins Protein Expr Purif, 1997 11(1): p 1-16 29 Novagen (2006), pET System Manual, TB055 11th Edition, Rev.B 0403, USA 800-207-0144 30 Ooi, M.H., et al., Clinical features, diagnosis, and management of enterovirus 71 Lancet Neurol, 2010 9(11): p 1097-105 31 QIAGEN 2006 QIAprep® Miniprep Handbook 32 QIAGEN 2007 QIAamp® Vữal RNA Mini Handbook -5333 QIAGEN 2008 QIAquick® Gel Exttaction Handbook 34 Qi-han LI, et al., Genetic analysis of the VP1 region of human enterovirus 71 strains isolated in Fuyang, China, during 2008 VIROLOGICA SINICA, June 2009, 24 (3):162-170 35 Shi, M., et al., Expression of enterovirus 71 capsid protein VP1 in Escherichia coli and its clinical application Braz J Microbiol, 2013 44(4): p 1215-22 36 Shih, S.R., et al., Expression of capsid [correction ofcaspid] protein VPỈ for use as antigen for the diagnosis of enterovirus 71 infection J Med Vữol, 2000 61(2): p 228-34 37 Solomon, T., et al., Virology, epidemiology, pathogenesis, and control of enterovirus 71 Lancet Infect Dis, 2010 10(11): p 778-90 38 Tee, K.K., et al., Evolutionary genetics of human enterovirus 71: origin, population dynamics, natural selection, and seasonal periodicity of the VP1 gene J Vừol, 2010 84(7): p 3339-50 39 Tu, P.V., et al., Epidemiologic and virologic investigation of hand, foot, and mouth disease, southern Vietnam, 2005 Emerg Infect Dis, 2007 13(11): p 1733-41 40 Tung, W.S., et al., DNA vaccine constructs against enterovirus 71 elicit immune response in mice Genet Vaccines Ther, 2007 5: p 41.77ỈC QIAexpressionistTM (2003), A handbook for high-level expression and purification of 6xHis-taggedproteins, Fifth edition, QIAGEN, Germany 42 ThermoFisher Scientific User Guide: Random Hexamer Primer Catalog number: so 142 43 Western Blotting Handbook and Troubleshooting Guide 44 WHO (World Health Organization) 2011.A Guide to Clinical Management and Public Health Response for Hand, Foot and Mouth Disease (HFMD) 45 Zhang, Y.X., et al., Construction and characterization of an infectious cDNA clone of enterovirus type 71 subgenotype C4 Virus Genes, 2013 47(2): p 235-43 Tài liệu Internet 46 httD://www unÌDrot.ors/unĨDrot/066478 PHỤ LỤC Trình tự VP1 phân nhóm C4 phân lập Việt Nam GGAGATAGGGTGGCAGATGTGATTGAAAGTTCCATAGGAGATAGC -54GTGAGCAGAGCCCTCACTCACGCTCTACCAGCACCCACAGGCCAGA ACACACAGGTGAGCAGTCATCGACTGGATACGGGCAAGGTTCCAG CACTCCAAGCTGCTGAAATTGGAGCATCATCAAATGCTAGTGACGA GAGTATGATTGAGACACGCTGTGTTCTCAACTCGCACAGTACAGCA GAGACCACTCTTGATAGTTTCTTCAGCAGGGCGGGATTAGTTGGAG AGATAGATCTCCCTCTTGAGGGCACAACTAACCCAAATGGTTATGC CAACTGGGACATAGATATAACAGGTTACGCGCAAATGCGTAGAAA GGTAGAGCTATTCACCTACATGCGCTTTGATGCAGAGTTCACTTTTG TTGCGTGCACACCTACCGGGGAAGTTGTCCCACAATTGCTCCAATA TATGTTTGTGCCACCTGGAGCCCCTAAGCCAGATTCTAGGGAATCC CTTGCATGGCAAACCGCCACTAACCCCTCAGTTTTTGTCAAGCTGTC AGACCCTCCAGCGCAGGTTTCAGTGCCATTCATGTCACCTGCGAGT GCTTATCAATGGTTTTATGACGGATATCCCACATTCGGAGAACACA AACAGGAGAAAGATCTTGAATACGGGGCATGTCCTAATAACATGA TGGGCACGTTCTCAGTGCGGACTGTAGGGACCTCCAAGTCCAAGTA CCCTTTAGTGGTTAGGATTTACATGAGAATGAAGCACGTCAGGGCG TGGATACCTCGCCCGATGCGTAACCAGAACTACCTATTCAAAGCCA ACCCAAATTATGCTGGCAACTCCGTTAAGCCAACTGGTGCCAGTCG CACAGCGATCACCACTCTT Trình tự acid amin protein VP1 sau dịch mã phần mềm Bioedit GDRVADVIESSIGDSVSRALTHALPAPTGQNTQVSSHRLDTGKVPALQ AAEIGASSNASDESMIETRCVLNSHSTAETTLDSFFSRAGLVGEIDLPLE GTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGE VVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVP FMSPASAYQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRTVG TSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSVK PTGASRTAITTL Luận văn Thạc sỹ Phụ lục ... : 60.42.02.01 l TÊN ĐỀ TÀI: Tách dòng biểu gen VP1 Enterovirus 71 II NHIỆM VỤ VÀ NỘI DUNG: - Tạo dòng gen VP1 EV71 hệ thống biểu pET SUMO - Tối ưu hóa biểu protein VP1 tế bào E.coli DE3 (E.coli... biểu - Chúng biểu thành công protein VP1 tái tổ hợp tế bào E.coli DE3 (BL21) Protein tái tổ hợp biểu chủ yếu nằm dạng thể vùi Chúng khảo sát điều kiện biểu tìm điều kiện biểu tối ưu protein VP1. .. thu số thành công định: - Đoạn gen VP1 phân lập từ chủng Enterovirus 71 phân nhóm C4 (VND11/202N2) nối thành công vào vector pET SUMO tạo vector tái tổ hợp pET SƯMO -VP1 Vector tái tổ hợp sau biến

Ngày đăng: 27/02/2020, 18:44

Nguồn tham khảo

Tài liệu tham khảo Loại Chi tiết
3. N.T.H.Thanh., et al., (2010), Bệnh tay chân miệng ở người năm 2008 do virus đường ruột tuy 71 và virus Coxsackie A16, Tạp chí Y học dự phòng, Tập XX số 6 (114), tr: 46-52 Sách, tạp chí
Tiêu đề: Tạp chí Y học dự phòng
Tác giả: N.T.H.Thanh., et al
Năm: 2010
5. PGS.TS. Trần Đình Bình - Bộ môn Vi sinh vật Y học, Trường Đại học Y Dược Huế. Coxsackievirus và bệnh tay chân miệng. Thông tin khoa học 2011 Sách, tạp chí
Tiêu đề: Coxsackievirus và bệnh tay chân miệng
6. Trần Ngọc Hữu. 2012. Đặc điểm dịch tễ học bệnh tay chân miệng ở 20 tỉnh thành phía Nam Việt Nam, giai đoạn 2005-2011. Tạp chí ung thư học Việt Nam, số 1-2012.Tài liệu tiếng Anh Sách, tạp chí
Tiêu đề: Đặc điểm dịch tễ học bệnh tay chân miệng ở 20 tỉnh thành phía Nam Việt Nam, giai đoạn 2005-2011
8. Amersham, GST Gene Fusion System Handbook, Edition AA, 18-1157- 58 (http://www. amershambiosciences .com) Sách, tạp chí
Tiêu đề: GST Gene Fusion System Handbook
9. Cardosa, M.J., et al., Molecular epidemiology of human enterovirus 71 strains and recent outbreaks in the Asia-Pacific region: comparative analysis of the VP1 and VP4 genes. Emerg Infect Dis, 2003. 9(4): p. 461-8 Sách, tạp chí
Tiêu đề: Molecular epidemiology of human enterovirus 71 strains and recent outbreaks in the Asia-Pacific region: comparative analysis of the VP1 and VP4 genes
10. Chan, Y.F. and s. AbuBaker, Recombinant human enterovirus 71 in hand, foot and mouth disease patients. Emerg Infect Dis, 2004. 10(8): p. 1468-70 Sách, tạp chí
Tiêu đề: Recombinant human enterovirus 71 in hand, foot and mouth disease patients
11. Chen, H.L., et al., Expression ofVPl protein in the milk of transgenic mice: a potential oral vaccine protects against enterovirus 71 infection. Vaccine, 2008. 26(23): p. 2882-9 Sách, tạp chí
Tiêu đề: Expression ofVPl protein in the milk of transgenic mice: a potential oral vaccine protects against enterovirus 71 infection
12. Chen, X., et al., A new baculovirus of cultured shrimps. Sci China c Life Sci, 1997. 40(6): p. 630-5 Sách, tạp chí
Tiêu đề: A new baculovirus of cultured shrimps
13. De Jesus, N.H., Epidemics to eradication: the modem history of poliomyelitis. Vhol J, 2007. 4: p. 70 Sách, tạp chí
Tiêu đề: Epidemics to eradication: the modem history of poliomyelitis
14. Fernandez, J.M. and J.p. Hoeffler, Gene expression systems : using nature for the art of expressionl999, San Diego: Academic Press, xii, 480 p Sách, tạp chí
Tiêu đề: Gene expression systems : using nature for the art of expressionl999
15. Fikrig, E., et al., Protection of mice against the Lyme disease agent by immunizing with recombinant OspA. Science, 1990. 250(4980): p. 553-6 Sách, tạp chí
Tiêu đề: Protection of mice against the Lyme disease agent by immunizing with recombinant OspA
20. Ke, Y.Y., Y.c. Chen, and T.H. Lin, Structure of the virus capsid protein VP1 of enterovirus 71 predicted by some homology modeling and molecular docking studies. J Comput Chem, 2006.27(13): p. 1556-70 Sách, tạp chí
Tiêu đề: Structure of the virus capsid protein VP1 of enterovirus 71 predicted by some homology modeling and molecular docking studies
21. Kew, O.M., et al., Prolonged replication of a type 1 vaccine-derived poliovirus in an immunodeficient patient. J Clin Microbiol, 1998. 36(10): p. 2893-9 Sách, tạp chí
Tiêu đề: Prolonged replication of a type 1 vaccine-derived poliovirus in an immunodeficient patient
23. McMinn, P.C., An overview of the evolution of enterovirus 71 and its clinical and public health significance. FEMS Microbiol Rev, 2002. 26(1): p. 91- 107 Sách, tạp chí
Tiêu đề: An overview of the evolution of enterovirus 71 and its clinical and public health significance
25. Nasri, D., et al., Basic rationale, current methods and future directions for molecular typing of human enterovirus. Expert Rev Mol Diagn, 2007. 7(4): p. 419-34 Sách, tạp chí
Tiêu đề: Basic rationale, current methods and future directions for molecular typing of human enterovirus
28. Nilsson, J., et al., Affinity fusion strategies for detection, purification, and immobilization of recombinant proteins. Protein Expr Purif, 1997. 11(1): p. 1-16 Sách, tạp chí
Tiêu đề: Affinity fusion strategies for detection, purification, and immobilization of recombinant proteins
30. Ooi, M.H., et al., Clinical features, diagnosis, and management of enterovirus 71. Lancet Neurol, 2010. 9(11): p. 1097-105 Sách, tạp chí
Tiêu đề: Clinical features, diagnosis, and management of enterovirus 71
34. Qi-han LI, et al., Genetic analysis of the VP1 region of human enterovirus 71 strains isolated in Fuyang, China, during 2008. VIROLOGICA SINICA, June 2009, 24 (3):162-170 Sách, tạp chí
Tiêu đề: Genetic analysis of the VP1 region of human enterovirus 71 strains isolated in Fuyang, China, during 2008
35. Shi, M., et al., Expression of enterovirus 71 capsid protein VP1 in Escherichia coli and its clinical application. Braz J Microbiol, 2013. 44(4): p. 1215-22 Sách, tạp chí
Tiêu đề: Expression of enterovirus 71 capsid protein VP1 in Escherichia coli and its clinical application
36. Shih, S.R., et al., Expression of capsid [correction ofcaspid] protein VPỈ for use as antigen for the diagnosis of enterovirus 71 infection. J Med Vữol, 2000. 61(2): p. 228-34 Sách, tạp chí
Tiêu đề: Expression of capsid [correction ofcaspid] protein VPỈ for use as antigen for the diagnosis of enterovirus 71 infection

TỪ KHÓA LIÊN QUAN

TÀI LIỆU CÙNG NGƯỜI DÙNG

TÀI LIỆU LIÊN QUAN

w