Sammys hill a novel

Báo cáo y học: "Endoscopic Facet Debridement for the treatment of facet arthritic pain – a novel new technique

Báo cáo y học: "Endoscopic Facet Debridement for the treatment of facet arthritic pain – a novel new technique

... low back pain Pain Physician 1999;2:59-64 Manchikanti L, Pampati V, Fellows B, et al The diagnostic validity and therapeutic value of lumbar facet joint nerve blocks with or without adjuvant agents ... men; mean age 64, range 22-89) were included Length of follow-up was at least years with a maximum of years Location of facet pain was cervical in 45, thoracic in 15, and lu...

Ngày tải lên: 26/10/2012, 09:32

4 600 0
Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"

Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"

... region of < /b> the < /b> type A < /b> human natriuretic < /b> peptide < /b> receptor gene and association analysis using a < /b> novel < /b> microsatellite in essential hypertension Am J Hypertens 1999; 12: 1144-8 26 Takahashi Y,< /b> Nakayama ... Germany) Int J Med Sci 2007, Statistical analysis Data are presented as the < /b> mean ± SD The < /b> Hardy-Weinberg equilibrium...

Ngày tải lên: 26/10/2012, 10:04

7 612 1
Báo cáo y học: " Vgf is a novel biomarker associated with muscle weakness in amyotrophic lateral sclerosis (ALS), with a potential role in disease pathogenesis"

Báo cáo y học: " Vgf is a novel biomarker associated with muscle weakness in amyotrophic lateral sclerosis (ALS), with a potential role in disease pathogenesis"

... length Vgf content in CSF in ALS In A, full-length Vgf was assessed by quantitative ELISA assays; in B, Vgf content decreased as a function of progression of muscle weakness assessed by manual muscle ... Macgrogan D, Ho L, Suh J, Humala N, Thiyagarajan M, Wang J, Pasinetti GM A ketogenic diet as a potential novel therapeutic intervention in amyotrophic late...

Ngày tải lên: 03/11/2012, 10:52

8 503 0
Domestic Wastewater Reclamation Coupled with Biofuel/Biomass Production Based on Microalgae: A Novel Wastewater Treatment Process in the Future

Domestic Wastewater Reclamation Coupled with Biofuel/Biomass Production Based on Microalgae: A Novel Wastewater Treatment Process in the Future

... with biofuel/biomass production based on microalgae considers wastewater as a kind of resource instead of just waste, and shifts the wastewater treatment process from being a mere treatment process ... reclamation coupled with biofuel/biomass production based on microalgae Novel concepts Several novel concepts for the novel process proposed fo...

Ngày tải lên: 05/09/2013, 10:17

9 762 0
Research on a novel buck boost converter for wind turbine systems

Research on a novel buck boost converter for wind turbine systems

... the operation for this inverter have proved its feasibility for dc-ac conversion in wind turbine applications ACKNOWLEDGMENT The authors wish to thank Natural Sciences and Engineering Research Council ... possibility for a low cost and high efficiency dc-ac converter appropriate for small wind turbine applications The inverter has a low component count with only power...

Ngày tải lên: 03/01/2014, 19:16

6 418 0
A novel interval method for validating state enclosures of the

A novel interval method for validating state enclosures of the

... where m = for Case and m = for Case The interval enclosures for all state variables and the initial approximations xapp,1 (t) and xapp,2 (t) are shown in Fig In the considered time span, the improved ... to the case of uncertain initial states to present the solver VAL E NC IA-IVP It aims at calculating tight enclosures [xencl (t)] for the unknown exact range [...

Ngày tải lên: 12/01/2014, 22:04

12 373 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... T thermophilus E coli A pernix 277 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic ac...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

... A novel high-activity D-hydantoinase from Jannaschia sp CCS1 obtain optically pure amino acids, namely chemical and enzymatic syntheses Chemical synthesis gives racemic mixtures of amino acids ... precipitate fraction; sup, supernatant fraction The molecular weight standard (lane M) is indicated on the right A novel high-activity D-hydantoinase from Jannaschia sp...

Ngày tải lên: 18/02/2014, 08:20

14 621 0
Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf

Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf

... Biotin-TCGACTAGAAGCTTCTAGAAGCTTCTAG AGCTGATCTTCGAAGATCTTCGAAGAT Biotin-TCGACTTCAAGCTTGTACAAGCTTGTAG AGCTGAAGTTCGAACATGTTCGAACATC Biotin-AACGACGGTCGCTCCGCCTGGCT nM Unlabeled HSE DNA-binding activity ... confirm that the assay specifically measures HSF1 DNA-binding activity Analytical range and precision The analytical range of the assay was evaluated using known concentrations of recombi...

Ngày tải lên: 18/02/2014, 14:20

9 457 0
Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc

Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc

... both a novel C-terminal actin- binding submodule (CABS) containing a novel actin monomer binding verprolin homology C-terminal (VH2-C) domain and a second submodule comprising the previously characterized ... actinbinding domain (this actin- binding domain has not yet been mapped) [23] We name the actin- binding domain that we have identified VH2-C and VH2-...

Ngày tải lên: 18/02/2014, 16:20

23 680 0
Tài liệu Báo cáo khoa học: Identification of a novel matrix protein contained in a protein aggregate associated with collagen in fish otoliths pdf

Tài liệu Báo cáo khoa học: Identification of a novel matrix protein contained in a protein aggregate associated with collagen in fish otoliths pdf

... aragonite crystals [4–7] We therefore examined proteins contained in aggregates within the otolith matrix and identified a protein contained in the HMW protein glycosaminoglycan aggregate that also ... digestion of genomic DNA contamination in the total RNA was confirmed by lack of amplification of a b-actin mRNA fragment by PCR using a pair of primers (5¢-ATCACCAT...

Ngày tải lên: 18/02/2014, 17:20

12 569 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... occludin variant deleted in exon (OccDE9) On the basis of a comparative analysis of the involvement of wild-type occludin (OccWT) and variant occludin in apoptosis and invasion, as determined by assay, ... 5¢-CAGCAATTGTCACACATCAAGAA-3¢ (sense) and 5¢-T-ACATGTAGGTATGAAGACATCGTC T-3¢ (antisense) for exon 9; 5¢-TCCCTGCTTCCTCTGGC GGA-3¢ (sense) and 5¢-AGCCA...

Ngày tải lên: 18/02/2014, 18:20

12 613 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... receptors, and invertebrate tachykinins: a review Zool Sci 5, 53 3–5 49 Satake H, Ogasawara M, Kawada T, Masuda K, Aoyama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykinin and ... peptides and their receptors in the common octopus (Octopus vulgaris) Biochem J 387, 8 5–9 1 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional...

Ngày tải lên: 19/02/2014, 00:20

11 595 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... mitochondria was analyzed by thiobarbituric acid assay [34] In this assay, thiobarbituric acid reacts with malonaldehyde and or other carbonyl by-products of free-radicalmediated lipid peroxidation ... glutathione peroxidase activity J Am Chem Soc 111, 5936 5939 12 Iwaoka M & Tomoda S (1994) A model study on the effect of an amino group on the antioxidant activity of glutathione...

Ngày tải lên: 19/02/2014, 02:20

9 491 0
w