keeping time a novel

Ngày tải lên: 21/06/2014, 19:20

Ngày tải lên: 22/06/2014, 20:20

... of fol- low-up was at least 3 years with a maximum of 6 years. Location of facet pain was cervical in 45, tho- racic in 15, and lumbar in 114 patients. Surgical times varied based on the number ... Primary outcome measure was percent change in facet-related pain as measured by Visual Analog Scale (VAS) score at final follow-up visit. Secondary outcome was change in OSWESTRY disability index ... dorsal nerve medial branch, Staender et al. 17 reported a mean VAS pain score re- duction of 3.3 at six months follow-up; 40% of patients had relief for at least 12 months, and mean duration...

Ngày tải lên: 26/10/2012, 09:32

... Tamura N, Ogawa Y, Chusho H, et al. Cardiac fibrosis in mice lacking brain natriuretic peptide. Proc Natl Acad Sci USA. 2000; 97: 4239-44. 7. Mukoyama M, Nakao K, Saito Y, et al. Human brain ... 5’-AAGGAGGCACTGGGAGAGGGGAAAT-3’ (bases -1323 to -1299) and antisense, 5’- CCCCACCAAGCCAACACAGGATGGA -3’ (bases -919 to-895) were used to amplify a 429-bp product from genomic DNA (Fig. 1A) . The PCR ... thermal asymmet- ric interlaced polymerase chain reaction. Med Sci Monit. 2001; 7: 345-9. 14. Ogawa Y, Itoh H, Nakagawa O, et al. Characterization of the 5'-flanking region and chromosomal...

Ngày tải lên: 26/10/2012, 10:04

... Zhao Z, Lange DJ, Voustianiouk A, Macgrogan D, Ho L, Suh J, Humala N, Thiyagarajan M, Wang J, Pasinetti GM. A ketogenic diet as a potential novel therapeutic intervention in amyotrophic lateral ... incubation with a reporter antibody (HRP–conjugated anti–rabbit IgG, Santa Cruz Biotech, CA). The assay was developed using a stabilized HRP substrate. All samples were analyzed in the linear ... by ALS grant from the Department of Veterans Affairs, NCCAM 5R21 AT002602-02 and NCCAM 1R21 AT003632-0 1A1 to GMP and NARSAD and DK071308 to SRS. Conflict of interest The authors have declared...

Ngày tải lên: 03/11/2012, 10:52

Ngày tải lên: 05/09/2013, 10:17

... as, )sin( 22 2 s 2 dc ac t L kTV i ω = (4) In practical implementation of an inverter control, a sinusoidal reference wave, serving as the modulating signal, is compared with a triangular ... proposed flyback single-stage single-phase buck-boost inverter can accomplish both buck and boost operation, feeding power to a grid with a reasonable power quality from a widely variable dc source. ... the voltage boost [1]. Although they can accommodate a wide range of input voltage, the complicated structure makes them costly, particularly for small wind turbine systems. A single-stage inverter...

Ngày tải lên: 03/01/2014, 19:16

... enclosures are 2 the words validated, guaranteed, and verified are used interchangeably to denote that state enclosures are mathematically and not only empirically proven to be correct. Traditional validated ... II-C. Although they are fairly efficient for exactly known initial states and parameters, they are sometimes insufficient for practical scenarios with uncertain but bounded initial states and parameters which ... information about ValEncIA-IVP as well as free software are available at http://www.valencia-ivp.com. 6 of the error bounds  R (κ+1) (t)  . Note that neither separate calculation of bounds for time...

Ngày tải lên: 12/01/2014, 22:04

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamic acid ... from Azotobacter vinelandii, ZP_00417949; FNR from Rhodobact- er capsulatus, AAF35905; ADR from Homo sapiens, AAB59498; adrenodoxin reductase from Saccharomyces cerevisiae, AAB64812; FprA from...

Ngày tải lên: 18/02/2014, 08:20

... molecular basis of enzyme thermosta- bility. J Bacteriol 185, 4038–4049. 20 Nanba H, Yajima K, Takano M, Yamada Y, Ikenaka Y & Takahashi S (1997) Process for producing d-N-car- bamoyl -a- amino acid. ... Bommarius AS, Schwarm M & Drauz K (1998) Biocatal- ysis to amino acid-based chiral pharmaceuticals - exam- ples and perspectives. J Mol Catal B-Enzym 5, 1–11. 14 Liljeblad A & Kanerva LT ... DNA sequences flanking the Jannaschia sp. CCS1 HYD Js revealed an ORF encoding a putative allantoate amido- hydrolase, which is part of the urate catabolic pathway in many organisms [8]. In fact,...

Ngày tải lên: 18/02/2014, 08:20

... antisense AGCTGATCTTCGAAGATCTTCGAAGAT Mutated HSE sense Biotin-TCGACTT CAAGCTTGTACAAGCTTGTAG Mutated HSE antisense AGCTGAAGTTCGAACATGTTCGAACATC ‘Scrambled’ oligonucleotide Biotin-AACGACGGTCGCTCCGCCTGGCT 140 40 60 80 100 120 Counts ... compilation ª 2009 FEBS TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses Kristiina A. Vuori 1 , Johanna K. Ahlskog 2 , Lea Sistonen 2 and Mikko ... procedure The assay was run as a three-step assay: initial incubation of the sample and probe, addition and incubation of the sample and acceptor beads in the plate wells, and addition of donor beads with...

Ngày tải lên: 18/02/2014, 14:20

... organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain Thirumaran Thanabalu 1,2 , Rajamuthiah Rajmohan 2 , Lei Meng 2 , Gang Ren 4,5 , Parimala R. ... polyclonal GFP-spe- cific antiserum was a gift from J. Kahana and P. Silver (Dana Farber Cancer Center, Boston, MA). The anti-actin mAb was MAB1501 from Chemicon International (Teme- cula, CA). The anti-hexokinase ... vrp1D::KanMx bar1) [23], IDY166 (MATa his3 leu2 ura3 trp1 las17D::URA3 ) [20], and PJ69- 4A (MATa his3 leu2 ura3 trp1 gal4D gal80D met2::GAL7-lacZ GAL2-ADE2 LYS2::GAL1–HIS3) [64]. Yeast strain PJ69-4A...

Ngày tải lên: 18/02/2014, 16:20

... 5¢-CGCCTCGAGCTATTTGGGCTCTT TCATCAT-3¢; rOMM-64-IV, 5¢-CGCGGATCCGCCCCT GTTAATGATGGAACC-3¢ and 5¢-CGCCTCGAGCTAA GAAGACTGGGCTGCCAG-3¢; rOMM-64-V, 5¢-CGCGG ATCCAGGCAAGATTTTAAGCATCCA-3¢ and 5 ¢-CGCC TCCACCTAAGAGGCATCCTTGTCCAC-3¢; ... 5¢-CGCCTCCA CCTAAGAGGCATCCTTGTCCAC-3¢; rOMM-64-II, 5¢- CGCGGATCCACCGTAGACACTTATGATATA-3¢ and 5¢-CGCCTCGAG CTAAGAGTCAG CTTGCACGTC-3 ¢; rOMM-64-III, 5¢-CGCGGATCCGCTGATGTGACCAGT GATGAC-3¢ and 5¢-CGCCTCGAGCTATTTGGGCTCTT TCATCAT-3¢; ... 3-1-1 Minato, Hakodate, Hokkaido 041-8611, Japan Tel ⁄ Fax: +81 138 40 5550 E-mail: takagi@fish.hokudai.ac.jp Database Nucleotide sequence data are available in the DDBJ ⁄ EMBL ⁄ GenBank databases...

Ngày tải lên: 18/02/2014, 17:20

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the mean and standard deviation of ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspase assay was performed using the CaspACE colorimetric assay kit as described by the manufacturer (Promega)....

Ngày tải lên: 18/02/2014, 18:20

... vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated ... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris. ... artificial seawater at 18 °C. Cloning of the partial-length cDNA Total RNA was extracted from Octopus tissues using Sepa- sol-RNA I Super (Nacalai tesque, Kyoto, Japan) according to the manufacturer’s...

Ngày tải lên: 19/02/2014, 00:20

... NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical Plant (Beijing, ... swelling and a decrease in mitochondria integrity. TBARS content in ferrous sulfate ⁄ ascorbate-treated mitochondria was analyzed by thiobarbituric acid assay [34]. In this assay, thiobarbituric acid ... experi- ment carried out without the mimic, ascorbate, and ferrous sulfate was known as the control group. Biological analysis of mimics against mitochondrial damage Mitochondrial swelling was assayed as...

Ngày tải lên: 19/02/2014, 02:20

... Michelis MI (2002) A novel interaction partner for the C-termi- nus of Arabidopsis thaliana plasma membrane H + -ATP- ase (AHA1 isoform): site and mechanism of action on H + -ATPase activity differ ... gatggatcccatATGGGTG TTGAAGTTGTA annealing around the start codon of the Ppi1 ORF and gactcgagATTAGTCGACTTCTTACGC annealing just before the putative transmembrane domain (capital letter in the sequence ... Villalba JM, Lanfermeijer FC & Palmgren MG (1995) C-terminal deletion analysis of plant plasma membrane H + -ATPase: yeast as model system for sol- ute transport across the plasma membrane....

Ngày tải lên: 19/02/2014, 07:20

... 5¢-GGGAATTCCATATGAGAGACAATA TTTCCCGTTTATCAAATC-3¢ and 5¢-CCGCTCGAGT CATTACTAGGTTCCCTGTCCAGTGTTACC-3¢,and PDE1(Lys321–Thr620) was amplified with primers 5¢-GGG AATTCCATATGAAGAATGATCAATCTGGCTGCG GCGCAC-3¢ and 5¢-CCGCTCGAGTCATTACTAGG TTCCCTGTCCAGTGTTACC-3¢. ... parasites as potential targets for antiparasitic drugs. The African trypanosome Trypanosoma brucei is the protozoon that causes the fatal human sleeping sickness, as well as Nagana, a devastating disease ... truncated fragments of TbPDE1 were also amplified using the same protocol and pET-PDE1 as template. PDE1(Arg189–Thr620) was amplified using the primer pairs 5¢-GGGAATTCCATATGAGAGACAATA TTTCCCGTTTATCAAATC-3¢...

Ngày tải lên: 19/02/2014, 12:20

Ngày tải lên: 19/02/2014, 13:20

Ngày tải lên: 19/02/2014, 13:20