a novel fpga fuel cell system controller design

Tài liệu A systematic computer-aided approach to cooling system optimal design in plastic injection molding docx

Tài liệu A systematic computer-aided approach to cooling system optimal design in plastic injection molding docx

... have been made on the mold cooling analysis. There are mainly two approaches considered for the mold cooling analysis: cycle- averaged approach and transient approach. In cycle-averaged approach, ... performance of the cooling system, a more accurate transient analysis can enhance the unde rstanding of shrinkage and warpage of the plastic part. Hu et al. [11] adopted the dual reciprocity boundary ... integrating the cooling analysis and optimization programs into the design process. Using such a tool, a design can be improved systematically, automatically and efficiently. The analysis of heat...

Ngày tải lên: 12/02/2014, 22:20

10 1,3K 2
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly- merase was purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamic acid ... T m value of each protein at neutral pH. a Data from this study. b Data from Griffin et al. [32]. c Data from Yano et al. [4]. T. Mandai et al. Thermostable electron transport system FEBS Journal...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (Applied Biosystems). Primers for methylated DNA were: 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ ... 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells subjected to the caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspase assay ... Boston, MA, USA). Cell proliferation assay For the cell proliferation assay, cells were seeded on the 96-well plates, transfected using FuGENE 6 according to the manufacturer’s manual, and incubated...

Ngày tải lên: 18/02/2014, 18:20

12 613 0
Tài liệu Báo cáo khoa học: KIPase activity is a novel caspase-like activity associated with cell proliferation doc

Tài liệu Báo cáo khoa học: KIPase activity is a novel caspase-like activity associated with cell proliferation doc

... units. Caspases and inhibitors Caspase substrates and their inhibitors were purchased from Biomol. Ac-DEVD-AMC is a substrate for caspases 3 and 7; Ac-YVAD-AMC is a substrate for caspase 1; Ac-IETD-AMC ... is a substrate for caspase 8 and 10; Ac-LEHD-AMC is a substrate for caspases 2, 4, 5 and 9. Ac-DVPD-AMC, Ac-DPSD-AMC and Ac-ESQD-AMC are tetra peptide substrates representing mdm-2, p27 KIP1 and ... Identification of paracaspases and metacaspases: two ancient families of caspase- like proteins, one of which plays a key role in MALT lymphoma. Mol. Cell 6, 961–967. Ó FEBS 2004 KIPase – a novel caspase-like...

Ngày tải lên: 19/02/2014, 13:20

8 443 0
Báo cáo khoa học: Gc recruitment system incorporating a novel signal amplification circuit to screen transient protein-protein interactions pot

Báo cáo khoa học: Gc recruitment system incorporating a novel signal amplification circuit to screen transient protein-protein interactions pot

... primers 5¢-AAATA TAAAACGCTAGCGTCGACATGGCGC-3¢ and 5¢-AGC GTAAAGGATGGGGAAAG-3¢. The final ratio of target cells was determined by counting the number of colonies retaining the target genes. Acknowledgements This ... yeast two-hybrid system. Mol Cell Biochem 172, 67–79. 8 Takesako K, Ikai K, Haruna F, Endo M, Shimanaka K, Sono E, Nakamura T, Kato I & Yamaguchi H (1991) Aureobasidins, new antifungal antibiotics. Taxonomy, ... we have established a powerful approach to screen weak and transient protein–protein interactions by incorporating a novel signal amplifica- tion circuit with intact Gc as an artificial signal ampli- fier...

Ngày tải lên: 05/03/2014, 23:20

9 537 0
Báo cáo khoa học: Effects of a novel arginine methyltransferase inhibitor on T-helper cell cytokine production pot

Báo cáo khoa học: Effects of a novel arginine methyltransferase inhibitor on T-helper cell cytokine production pot

... Purandare AV, Chen Z, Huynh T, Pang S, Geng J, Vaccaro W, Poss MA, Oconnell J, Nowak K & Jayar- aman L (2008) Pyrazole inhibitors of coactivator associ- ated arginine methyltransferase 1 (CARM1). ... demonstrated selectivity for the PRMTs, although AMI-6 was mini- mally active against a cellular PRMT substrate [8]. Computational modeling suggested that AMI-1 spans the SAM-binding and arginine-binding ... Proliferation assays were performed using the CellTiter 96 Aqueous One Solution Proliferation Assay reagent (Promega, Madison, WI, USA). Plasmids, transfections and luciferase assays GST–PRMT1 and GST–CARM1...

Ngày tải lên: 06/03/2014, 11:20

13 646 0
Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

... 5¢-CTAGACTCGAGCCTAAT TTATATTTGCTCCTTGTGC-3¢. b-Actin primers were designed as follows: forward 5¢-CTACAATGAGCTGCG TGT-3¢ and reverse 5¢-AAGGAAGGCTGGAAGAGT-3 ¢. Cell survival and apoptosis analysis For viability ... the yeast two-hybrid assay and using a mammalian hybrid system (Invitrogen, Carlsbad, CA) (EDA Wheeler & V Ayyavoo, unpublished data). A blast search revealed that the IMAGE clone, localized ... variant of ANKHD1 and may play a role in cellular apoptosis (antiapoptotic) and cell survival pathway(s). Abbreviations ANK, ankyrin repeat motif; ANKHD1, ankyrin repeat and KH domain 1; DMEM, Dulbecco’s...

Ngày tải lên: 07/03/2014, 21:20

12 561 0
Báo cáo khoa học: Construction of a novel detection system for protein–protein interactions using yeast G-protein signaling pdf

Báo cáo khoa học: Construction of a novel detection system for protein–protein interactions using yeast G-protein signaling pdf

... TCATCTTTTAAACTTTGGGCGAAGGCGTTT 23 TTTTCTCGAGAAAGATGCCGATTTGGGCGC 24 GGGGCTCGAGGTTTTATATTTGTTGTAAAA 25 ATATTATATATATATATAGGGTCGTATATA 26 AAATTATAGAAAGCAGTAGA TAAAACAATG 27 CTTCGAAGAATATACTAAAAAATGAGCAGG CAAGATAAACGAAGGCAAAGTTCAATTCA TCATTTTTTTTTTATTCTTTT 28 ... GCCCGGATCCTGATAGTAATAGAATCCAAA 4 CCCCGAATTCAAATTATAGAAAGCAGTAGA 5 AAGGCTCGAGAGATCTGTTTAGCTTGCCTC 6 AAAAGTCGACGAGCTCGTTTTCGACACTGG 7 TTTTGTCGACATGGCGCAACACGATGAAGC CGTAGACAAC 8 GGGGGGATCCTTACATAAGCGTACAACAAA CACTATTTGATTTCGGCGCCTGAGCATCA TTTAGCTTTTT 9 ... TTTTGTCGACATGGCGCAACACGATGAAGC CGTAGACAAC 18 GGGGGGATCCTTACATAAGCGTACAACAAA CACTATTTGATTTCGGCGCCTGAGCATCA TTTAGCTTTTT 19 ATCCAAAGTTTAGCCGATGACCCAAGCCAA 20 TTGGCTTGGGTCATCGGCTAAACTTTGGAT 21 AAACGCCTTCGCCCAAAGTTTAAAAGATGA 22 TCATCTTTTAAACTTTGGGCGAAGGCGTTT 23...

Ngày tải lên: 16/03/2014, 01:20

9 444 0
Ruta 6 selectively induces cell death in brain cancer cells but proliferation in normal peripheral blood lymphocytes: A novel treatment for human brain cancer doc

Ruta 6 selectively induces cell death in brain cancer cells but proliferation in normal peripheral blood lymphocytes: A novel treatment for human brain cancer doc

... (P.B. and P.B.) have used Ruta 6 and Ca 3 (PO 4 ) 2 combination therapy to treat 15 patients diagnosed with advanced intracranial malignant brain cancer at the PBH Research Foundation, Kolkata, ... intracranial brain cancers. The 15 patients (9 male, 6 female) with intracranial brain cancers who were treated with Ruta 6 + Ca 3 (PO 4 ) 2 at the PBH Research Foundation, Kolkata, India, had ... fragmentation of DNA, leading to cell death; h) FACS analysis indicates that Ruta induces cell death in a dose- and duration-dependent manner in human MGR1 brain cancer cells, followed by saturation effects....

Ngày tải lên: 22/03/2014, 17:20

8 671 0
Báo cáo khoa học: A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian skin pptx

Báo cáo khoa học: A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian skin pptx

... ATTAAGGAGCTTCGGGAGATG Exon 7 380 P558 CTCTTATACCCAATGCTGCTG Exon 10 CYP1 1A First pair P561 GCCTTTGAGTCCATCACTAAC Exon 4 628 P562 CCAGTGTCTTGGCAGGAATC Exon 8 Nested pair P563 ATGTGGCTGCATGGGACGTG ... control placenta, whole human skin, normal epidermal and immor- talized keratinocytes, dermal fibroblasts, squamous cell carcinoma and five human melanomas. Thus, these data clarify in detail the cutaneous ... specimens, subcutaneous adip ose tissue, epidermal and dermal cell lines [normal epidermal keratinocytes, immortalized keratino- cytes (HaCaT), dermal fibroblasts, squamous cell carci- noma, five human melanomas...

Ngày tải lên: 23/03/2014, 13:20

11 476 0
w