Molecular characterization of a novel tobamovirus infecting hibiscus

Molecular characterization of a novel tobamovirus infecting hibiscus

Molecular characterization of a novel tobamovirus infecting hibiscus

... Srinivasan KG and Wong SM (2003) Cloning and Characterization of a new tobamovirus infecting Hibiscus rosa-sinensis) L Annual Meeting and Symposium of Korean Society for Plant Pathology Srinivasan ... purified HVS RNA Mechanical inoculation of purified HVS on test plants and ultra-thin section of HVS infected N benthamiana leaves SDS-PAGE and western blot analysis of HVS a...

Ngày tải lên: 17/09/2015, 17:19

175 133 0
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

... A novel high-activity D-hydantoinase from Jannaschia sp CCS1 obtain optically pure amino acids, namely chemical and enzymatic syntheses Chemical synthesis gives racemic mixtures of amino acids ... precipitate fraction; sup, supernatant fraction The molecular weight standard (lane M) is indicated on the right A novel high-activity D-hydantoinase from Jannaschia sp...

Ngày tải lên: 18/02/2014, 08:20

14 621 0
Báo cáo khoa học: Molecular characterization of a novel nuclear transglutaminase that is expressed during starfish embryogenesis ppt

Báo cáo khoa học: Molecular characterization of a novel nuclear transglutaminase that is expressed during starfish embryogenesis ppt

... ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG AGAAGAAACAATTACTTCTTAAGTCAATTAATTTTTCTAGAAATGCAAAAGATATTCCCC TTAACAGCTGTTTGAAATGAGGCCTCGGTCTCAAGTTTAAGAGTGCCCCCATATGTAAGC TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG ... A H V T L N V K S A * ATGCGAGGTCAGCATTTATCCAACCAGAAGCTTCACGGAGCTAGCTGGGCAAGGAAATTT GATAATCGCAAGAAATAATTTCCCCCCAAAAACAAAAGGTTGTTGGCTGAAAATACTTCT...

Ngày tải lên: 08/03/2014, 10:20

11 502 0
Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

... sequence VBARP-L 1.9 VBARP-S 1.3 AACAATGCTGACTGATAGCGGAGGA (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 ... identified and functionally characterized VBARP, a novel splice variant of ANKHD1 Human ANKHD1 gene is a large transcript containing multiple ankyrin repeat motif domains a...

Ngày tải lên: 07/03/2014, 21:20

12 561 0
Tài liệu Báo cáo Y học: Characterization of a novel silkworm (Bombyx mori ) phenol UDP-glucosyltransferase potx

Tài liệu Báo cáo Y học: Characterization of a novel silkworm (Bombyx mori ) phenol UDP-glucosyltransferase potx

... project A wing disc cDNA library derived from fifth instar B mori C108 larvae was kindly provided by Dr Kawasaki (University of Utsunomiya, Japan) A total of 1000 clones were selected at random and ... the ATG start codon) for cDNA synthesis and 5¢-CCGTGATTGTTGAGTG GATG-3¢ and 5¢-AAGCAACTCCAGTAGACACG-3¢ (position 386–405 and 769–750, respectively, from the ATG start codon) for PCR am...

Ngày tải lên: 22/02/2014, 04:20

7 471 0
Báo cáo khóa học: Biochemical and molecular characterization of a laccase from the edible straw mushroom, Volvariella volvacea docx

Báo cáo khóa học: Biochemical and molecular characterization of a laccase from the edible straw mushroom, Volvariella volvacea docx

... although, as V volvacea produces at least one other laccase isoform in addition to lac1 [1], this and possibly other laccase isoforms may be contributing to the total laccase activity detected at the ... primers The putative N-glycosylation site is boxed; *; stop codon The putative polyadenylation signals (TATAAA and CATAAA) are in white on a black background Ó FEBS 200...

Ngày tải lên: 07/03/2014, 15:20

11 703 0
Báo cáo khoa học: Structural characterization of a novel branching pattern in the lipopolysaccharide from nontypeable Haemophilus influenzae pot

Báo cáo khoa học: Structural characterization of a novel branching pattern in the lipopolysaccharide from nontypeable Haemophilus influenzae pot

... Schweda, E.K.H (2001) A rapid and sensitive procedure for determination of 5-N-acetyl neuraminic acid in lipopolysaccharides of Haemophilus in uenzae: a survey of 24 nontypeable H in uenzae strains ... HexNAc1ÆHex5ÆHep4ÆAnKdo-ol (Tables and 4) The Table Negative ion ESI-MS data and proposed compositions for O-deacylated lipopolysaccharide (LPS-OH) of nontypeable Hae...

Ngày tải lên: 08/03/2014, 02:21

13 433 0
Báo cáo khoa học: Identification and functional characterization of a novel barnacle cement protein pptx

Báo cáo khoa học: Identification and functional characterization of a novel barnacle cement protein pptx

... VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG Mrcp19k Bacp19k Bicp19k 70 80 90 100 110 120 TSVSAGDGAFGNLAAALTLVEDTEDGLGVKTKNGGKGFSEGTAAISQTAGANGGATVKKA VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL AAAAAGNGVFKNLVTALTNISTTDDITKVQTQTIGSGGTGGAATILQLADANGGAALKEV ... underwater material surfaces was analyzed by: (a) quantitative amino acid analysis; and (b) SPR Pro...

Ngày tải lên: 16/03/2014, 05:20

11 488 0
Báo cáo khoa học: Molecular characterization of a blood-induced serine carboxypeptidase from the ixodid tick Haemaphysalis longicornis docx

Báo cáo khoa học: Molecular characterization of a blood-induced serine carboxypeptidase from the ixodid tick Haemaphysalis longicornis docx

... Boldbaatar D, Sikalizyo Sikasunge C, Battsetseg B, Xuan X & Fujisaki K (2006) Molecular cloning and functional characterization of an aspartic protease from the hard tick Haemaphysalis longicornis ... development, and thus improved tick control Experimental procedures Ticks Adults of H longicornis obtained from the parthenogenetic Okayama strain maintained at the L...

Ngày tải lên: 16/03/2014, 10:20

14 433 0
Báo cáo khoa học: Characterization of a novel long-chain acyl-CoA thioesterase from Alcaligenes faecalis docx

Báo cáo khoa học: Characterization of a novel long-chain acyl-CoA thioesterase from Alcaligenes faecalis docx

... MO, USA Bacterial strain The strain isolated from soil samples was identified as a bacterium, A faecalis according to Bergey’s Manual [31], and was designated A faecalis ISH108 The strain has been ... sample was withdrawn and assayed for activity by the DTNB method using stearoyl-CoA as substrate (c) In an analogous manner, when stearoyl-CoA was used as 2379 Thioesterase of Al...

Ngày tải lên: 16/03/2014, 13:20

14 513 0
Báo cáo khoa học: cDNA cloning and characterization of a novel calmodulinlike protein from pearl oyster Pinctada fucata potx

Báo cáo khoa học: cDNA cloning and characterization of a novel calmodulinlike protein from pearl oyster Pinctada fucata potx

... nucleotide sequence of oyster CaLP cDNA obtained by RACE, a PCR reaction was performed using a pair of specific primers P3 (5¢-GGAAGAATACAGACACGGACAG-3¢) and P4 (5¢-ATAACAACAGTTTATACATCGCTTC-3¢) corresponding ... metabolism and calcium signaling pathways Experimental procedures RNA preparation and cDNA synthesis Adult specimens of P fucata were purchased from Guofa P...

Ngày tải lên: 16/03/2014, 23:20

12 375 0
Báo cáo khoa học: Detection and characterization of a novel extracellular fungal enzyme that catalyzes the specific and hydrolytic cleavage of lignin guaiacylglycerol b-aryl ether linkages pdf

Báo cáo khoa học: Detection and characterization of a novel extracellular fungal enzyme that catalyzes the specific and hydrolytic cleavage of lignin guaiacylglycerol b-aryl ether linkages pdf

... (Fig 3A) These results indicated that the b-aryl ether cleavage enzyme accumulated and was stable in the extracellular fraction The extracellular fraction of 2BW-1 generated abundant GG and 4MU ... radiolabeled water was not observed with guaiacol It was clear that the b-aryl ether cleavage enzyme catalyzed the addition of two molecules of H2O (at C...

Ngày tải lên: 17/03/2014, 03:20

10 671 0
Báo cáo Y học: Identification and characterization of a novel activated RhoB binding protein containing a PDZ domain whose expression is specifically modulated in thyroid cells by cAMP pot

Báo cáo Y học: Identification and characterization of a novel activated RhoB binding protein containing a PDZ domain whose expression is specifically modulated in thyroid cells by cAMP pot

... PDZ domain showing 30% identity with the PDZ domains existing in a wide variety of proteins The protein ends by a potential PDZ binding domain motif (SSWY) and contains at least two potential ... presence of activated RhoB (Fig 4D) Regulation of p76RBE mRNA in vitro in thyroid cells As p76RBE was initially isolated from a dog thyroid cDNA library...

Ngày tải lên: 23/03/2014, 21:20

9 394 0
Báo cáo y học: "The identification and characterization of a novel protein, c19orf10, in the synovium" docx

Báo cáo y học: "The identification and characterization of a novel protein, c19orf10, in the synovium" docx

... staining (g) Intense staining of a hyperplastic RA synovial lining cell layer This staining was typical of most areas of RA synovium where the lining was hyperplastic (h) An area of an RA synovial ... stained positively (arrow) (e) Intense staining of individual cells in the lining layer of a typical OA synovium (f) An area of an OA synovium demonstrates a lining lay...

Ngày tải lên: 09/08/2014, 10:20

9 490 0
báo cáo khoa học: " Molecular characterization of a rice mutator-phenotype derived from an incompatible cross-pollination reveals transgenerational mobilization of multiple transposable elements and extensive epigenetic instability" ppt

báo cáo khoa học: " Molecular characterization of a rice mutator-phenotype derived from an incompatible cross-pollination reveals transgenerational mobilization of multiple transposable elements and extensive epigenetic instability" ppt

... [http://www.biomedcentral.com/content/supplementary/14712229-9-63-S2.doc] 10 Additional file Characterization of variant AFLP and MSAP bands Chromosomal location and functional homology of isolated variant AFLP and MSAP fragments from the mutator phenotype ... the manuscript XCC and JHZ performed all pollination work and maintained plants CMX and BL designed the study and...

Ngày tải lên: 12/08/2014, 03:20

12 303 0
w