imaging translocation of g protein bg subunit in response to receptor activation
Báo cáo y học: " Signaling and regulation of G protein-coupled receptors in airway smooth muscle" ppsx
Ngày tải lên :
13/08/2014, 13:20
... (GPCRs) involves sequential activation of receptor, G protein, and effector Upon agonist binding, the receptor undergoes a conformational change exposing a high-affinity binding site for a G- protein ... analyzing GPCR signaling in ASM Models for analyzing GPCR signaling in ASM run the spectrum of integrative to reductionist approaches, each having certain advantages and disadvantages Integrative in ... but may involve the need to maintain a degree of Gs-coupled receptor signaling in the face of persistent Gi-coupled receptor activation A role for Gi-coupled receptors in modulating growth in ASM...
- 23
- 363
- 0
Báo cáo khoa học: Proteolysis of the tumour suppressor hDlg in response to osmotic stress is mediated by caspases and independent of phosphorylation pot
Ngày tải lên :
23/03/2014, 06:20
... triggers its dissociation from the cytoskeletal protein GKAP, therefore releasing it from the cytoskeleton into the cytoplasm [3] Our aim in this study was to gain a better understanding of the ... degradation of hDlg F A Inesta-Vaquera et al ˜ A Staurosporine (µM) – + + hDlg (S158) hDlg (T209) hDlg (S431) hDlg (S442) hDlg (total) B hDlg is degraded in apoptotic cells These findings suggest ... amount of hDlg in the cytoplasm is greater in subconfluent cells, but in C 14 hDlg Sorbitol GAPDH hDlg UV-C GAPDH confluent cells hDlg is mainly in the membrane fraction (Fig 6B) After exposing the...
- 14
- 360
- 0
Báo cáo hóa học: " Complexity of VTA DA neural activities in response to PFC transection in nicotine treated rats" pdf
Ngày tải lên :
19/06/2014, 08:20
... affecting the firing of DA neurons in VTA Considering that the excitatory input to VTA DA neurons is mainly originated from the PFC, the above results suggests a possibility that systemic nicotine-induced ... method, to gain insights into the VTA DA neuronal activity induced by systemic administration of nicotine to both PFC intact and transected subjects The results obtained when using the LZ estimator ... condition in response to nicotine, two minutes of data with the effect of nicotine was analyzed with LZ complexity to understand the dynamics (complexity) of neural firing in response to nicotine exposure...
- 8
- 403
- 0
Báo cáo khoa hoc:" Global Transcriptome Analysis of Bacillus cereus ATCC 14579 in Response to Silver Nitrate Stress" pot
Ngày tải lên :
11/08/2014, 08:20
... expressing in response to silver metal stress, we have included those 900 ‘empty’ intergenic regions in the genomic microarray to detect transcripts arising from ‘empty’ intergenic regions of B ... Benotmane MA, Moniseurs P, Grass G, Doonan C, Vogt S, Lai B, Martinez-Criado G, George GN, Nies DH, Mergeay M, Pring A, Southam G, Brugger J: Mechanisms of gold biomineralization in the bacterium Cupriavidus ... (fliM, flgK, fliD, flgE, flgD and flgC) were induced in B cereus during early stages of silver stress (30 min) The prolonged silver stress leads to the decreased level of expression of genes involved...
- 37
- 236
- 0
báo cáo khoa học: " PR genes of apple: identification and expression in response to elicitors and inoculation with Erwinia amylovora" doc
Ngày tải lên :
12/08/2014, 05:20
... tacccccactactgcacctcact gtttgctgcgcccattag ttgcactttgaaacaccacatc agcttattttgggcatcttcacc gtagttttgccccatatcacacca cttcacagtcaccatcttcaaca ggtgcaccagctttttcaa ggcaggcgcagttccaccag gacatgtctccggcgtatca ... caaaaacggcaatgaaggaacc ctggcgagctcatcatagaactgc agaccaccaagtactactgcac ccaccaatcttgtacacatcc PR-1b PR-1c PR-2 PR-5 PR-8 EF1α shoots were inoculated similarly with P syringae pv tomato, a non-pathogen ... following traumatic events experienced by young growing shoots, through the activity of insects, wind-driven rain or hail The second method, slicing the young leaf lamina on both sides of the...
- 12
- 320
- 0
PURIFICATION OF SIMPL ANTIBODY AND IMMUNOFLUORESCENCE OF SIMPL SUB-CELLULAR LOCALIZATION IN RESPONSE TO TNFα- AND IL-1
Ngày tải lên :
24/08/2014, 12:43
... complement system to target pathogens Other roles of antibodies include blocking key receptors due to binding as well as segregation of possibly key proteins both of which may hinder pathogen survival ... measure the protein concentration of the post binding wash, and there was no detectable protein in the solution (data not shown) indicating 100% binding efficiency of the recombinant protein to the ... family of transcription factors that greatly impacts the fate of the cell It can affect the fate of cells in many ways including induction of anti-apoptotic signaling, regulation of cell cycling,...
- 63
- 162
- 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1
Ngày tải lên :
14/09/2015, 09:13
... subunit GAP Guanosine triphosphatase activating proteins GDP Guanosine diphosphate GEF Guanine-nucleotide exchange factors GIRK G protein- coupled inwardly rectifying potassium G protein Guanine nucleotide ... regulator of G protein signaling (RGS), leads to the replacement of GTP with GDP and reassociation of G with G γ heterodimer, leading to the termination of G protein- mediated signaling (Figure 3) ... Desensitization of G protein Signaling 1.2.3.1 The discovery of Regulator of G protein signaling (RGS) Studies of the desensitization of G- protein- coupled signal transduction have led to the discovery of...
- 220
- 228
- 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2
Ngày tải lên :
14/09/2015, 09:24
... 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA QQDRAYTAQYPGSQLFQPTKHSIYQITPNGKDLINGMNSRGRTSDAESTPRDHKPNEKLP QEDKGYPQPDASIVVFQPSKYAIYGITERGQRVCG -WIARDKSRETFYDNRGMP LIDSKHCDKKSNTSTSKNNIVKTIDSALMKQANECLEMAYHIYSSYIMIGSPYQLNIHHN ... HPH1 RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 ... ESPRNTMQLVNLERDTETDKLSHDRATIEVIFRRFAGQDGPNVKSSISTSDSDSLSDYSN FQISRSSFFTLSKRGWDLVSWTGCKSNNIRAPNGSTIDLDFTLRGHMTVRDEKKTLDDSE Rgs1 Cprgs-1 FlbA Sst2 408 213 420 406 GLTGVKMAPERKVNGKIHKDTFTGK-AASEWLMDCCTTVDRREAVEIASLFVEYELIEAL GLTGVKMAAERKIGGKTYKETFTGK-AATDWLMDCSTTVDRRETVEIASYFVEFGLMECV...
- 12
- 185
- 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3
Ngày tải lên :
14/09/2015, 09:39
... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure ... mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 MG010315 MG010105 MG09134 Control: Gamma actin MG03982 MG01173 MG01630 Figure 37 A B ...
- 11
- 227
- 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4
Ngày tải lên :
14/09/2015, 09:53
... Figure 39 WT rgs1D Figure 40 Figure 41 Figure 42 _ Figure 43 - Gd + Gd, 1h + Gd, 0h + Gd, 2h + Gd, 0.5h + Gd, 3h _ Figure 44 A WT rgs1D Solvent Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D ... Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87 2.5...
- 9
- 180
- 0
Tài liệu Báo cáo khoa học: Regulators of G-protein signalling are modulated by bacterial lipopeptides and lipopolysaccharide pptx
Ngày tải lên :
18/02/2014, 13:20
... to give the inactive heterotrimeric form [15] Regulators of G- protein signalling (RGS) interact directly with the G protein a subunit in order to inhibit G- protein signalling [16] RGS proteins ... 12 13 14 15 16 17 658 S Riekenberg et al of regulator of G protein signaling proteins in dendritic cells: implications for G protein- coupled receptor signaling J Immunol 172, 5175–5184 Hoebe ... well as G- protein inhibitors should be investigated to find out the participating proteins in RGS1 and RGS2 modulation In conclusion, our results show strong modulation of RGS1 and RGS2 mRNA induced...
- 11
- 569
- 0
Báo cáo khoa học: Identification of the structural determinant responsible for the phosphorylation of G-protein activated potassium channel 1 by cAMP-dependent protein kinase pdf
Ngày tải lên :
07/03/2014, 00:20
... by G protein- gated inwardly rectifying potassium (GIRK) channels Pflugers Arch 456, 1097– 1108 Stringer BK, Cooper AG & Shepard SB (2001) Overexpression of the G- protein inwardly rectifying potassium ... failure of these seven mutations to abolish protein phosphorylation was a result of other protein kinases masking the PKA-catalysed part Indeed, protein kinases other than PKA, including 6222 tyrosine ... comprising (amongst other signalling molecules) GIRK1, GIRK4, Gb ⁄ c, PKA, PP2A and protein phosphatase was identified to exist in rat atrial membranes in situ [21], supporting the physiological...
- 9
- 403
- 0
Báo cáo khoa học: Activation of nematode G protein GOA-1 by the human muscarinic acetylcholine receptor M2 subtype Functional coupling of G-protein-coupled receptor and G protein originated from evolutionarily distant animals doc
Ngày tải lên :
07/03/2014, 11:20
... stage of C elegans as a template with the following primers: M2-goa1-s, 5¢-CATTATAAGA ACATAGGCGCTACAAGGATGGGTTGTACCATGTC ACAGGAAG-3¢; M2-goa1-PstI-as, 5¢-CCAATGCATTGG TTCTGCAGTTAATACAAGCCGCATCCACGAAGA-3¢ ... K, Haga K, Haga T, Moro O & Sadee W (1994) Activation of a GTP-binding protein and a GTPbinding -protein- coupled receptor kinase (beta-adrenergic -receptor kinase-1) by a muscarinic receptor m2 ... conditions Human GPCR activates nematode G protein construct, pPAK-M2–Gai1 [25], as a template with the following primers: M2-myc-EcoRI-s, 5¢-CAGAATTCatg gagcagaagctgatctccgaggaggacctgctgGTGAACAACTCCAC...
- 9
- 400
- 0
Báo cáo khoa học: The variable C-terminal extension of G-protein-coupled receptor kinase 6 constitutes an accessorial autoregulatory domain ppt
Ngày tải lên :
07/03/2014, 12:20
... (1999) G- protein coupled ¨ receptor kinases as modulators of G- protein signalling J Physiol 517, 5–23 Ferguson SS (2001) Evolving concepts in G proteincoupled receptor endocytosis: the role in receptor ... single incubation at 72 °C for 10 min) using primer P1, 5¢-AGCCCATGGAGCTCGAGAACA TCGTA-3¢ (nucleotides 1–26, sense, initiating ATG underlined) in combination with antisense primers introducing ... introducing a stop codon sequence: mGRK6-A M2: P2, 5¢-CTAGTCGC TGGAGTTCCCAGAGGAATCTTGGCG-3¢ (nucleotides 1677–1706, antisense, stop codon underlined) and mGRK6A M3: P3, 5¢-CTAATCTTGGCGACTGAAGAGTCT-3¢...
- 13
- 424
- 0
Báo cáo khoa học: Covalent activation of heart AMP-activated protein kinase in response to physiological concentrations of long-chain fatty acids docx
Ngày tải lên :
07/03/2014, 15:20
... blocked inactivation of the AMPK by insulin (Fig 7), suggesting a dominance of the fatty acid-driven pathway for activation of AMPK over at least some aspects of insulin signalling This dominance of ... creatine kinase, glycogen synthase, phosphofructokinase 2, ceramide synthesis, glucose uptake, apoptosis, insulin receptor substrate 1, mammalian target of rapamycin kinase (mTOR), mitogen-activated ... to protein G- Sepharose 4B Antibody against a peptide surrounding phospho-Thr172 on the a-subunits of AMPK was from New England Biolabs Antibody against the phosphopeptide corresponding to amino...
- 10
- 551
- 0
Báo cáo khoa học: Involvement of the V2 receptor in vasopressin-stimulated translocation of placental leucine aminopeptidase/oxytocinase in renal cells pdf
Ngày tải lên :
08/03/2014, 02:20
... also suggest the presence of a minor population of AQP-2-containing vesicles Taken together, we suggest the biological relevance of our findings as follows The binding of AVP to V2 receptors on ... majority of P-LAP-containing vesicles have a relatively higher density when compared to AQP-2-containing vesicles, suggesting that these two proteins are differently distributed in the intracellular ... 0.5% Triton X-100, 10 lgÆmL)1 aprotinin) After determination of the protein concentration, cell lysate containing 100 lg of protein was diluted to 300 lL with lysis buffer, added 15 lL of immobilized...
- 7
- 544
- 0
Báo cáo Y học: Defective translocation of a signal sequence mutant in a prlA4 suppressor strain of Escherichia coli doc
Ngày tải lên :
08/03/2014, 09:20
... targeting to the mutant translocon To study this possibility, we examined the targeting of (G- 10L)prePhoE nascent chains to SecY in vitro in cross-linking experiments After translation, RNCs of ... PhoE in prlA4 mutant strain CE1512, using processing as a criterion for translocation The prlA4 phenotype of the strain was confirmed by studying the processing kinetics of (G- 10R)prePhoE The translocation ... amino-acid substitutions introducing a strong helix breaker, such as glycine, into the a-helical core region of the signal sequence [46] Similarly, streptokinase, an extracellular protein of...
- 9
- 493
- 0
Báo cáo khoa học: The impact of G-protein-coupled receptor hetero-oligomerization on function and pharmacology pptx
Ngày tải lên :
16/03/2014, 22:20
... internalization GPCR activation promotes recruitment of b-arrestin to the receptor site This leads to signal termination by blocking G- protein interaction and it triggers receptor internalization by endocytosis ... role in GPCR activation of mitogen-activated protein kinase (MAPK) In this context it may act as an adaptor or scaffolding for recruiting signaling molecules into a complex along with the agonist-occupied ... pharmacology of hetero-oligomers A B H GPCR GPCR H GPCR H H β-arrestin H GPCR H H GPCR GPCR H GPCR GPCR β-arrestin No effect No effect H GPCR H GPCR H GPCR β-arrestin β-arrestin H GPCR β-arrestin ERK activation...
- 8
- 488
- 0
Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc
Ngày tải lên :
16/03/2014, 22:20
... reasonable insights into the structural and functional features of the aminergic receptors Among them, 16 of 33 locations that are known to be involved in ligand binding in aminergic receptors were ... Domain swapping in G- protein coupled receptor dimers Prot Eng 11, 1181–1193 Gouldson PR, Higgs C, Smith RE, Dean MK, Gkoutos GV & Reynolds CA (2000) Dimerization and domain swapping in G- protein- coupled ... Dimerization of G- protein- coupled receptors J Med Chem 44, 4595–4614 Moller S, Vilo J & Croning MD (2001) Prediction of the coupling specificity of G protein coupled receptors to their G proteins Bioinformatics...
- 13
- 515
- 0
Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc
Ngày tải lên :
16/03/2014, 22:20
... reconstitution of function might simply reflect the higher concentration of G protein provided in the membranes by the : GPCR : G protein stoichiometry of the fusion proteins allowing the G protein fused to ... ligand-binding to a single class of noninteracting sites As such, cooperative characteristics of the binding of a antagonist is not compatible with such a model and may be used to infer protein protein ... GPCR signalling have produced data consistent with GPCR–GPCR interactions By generating mutants of the luteinizing hormone receptor that were either unable to bind ligand or unable to signal,...
- 12
- 337
- 0