g protein coupled receptors kinases arrestins and spinophilin

Báo cáo y học: " Signaling and regulation of G protein-coupled receptors in airway smooth muscle" ppsx

Báo cáo y học: " Signaling and regulation of G protein-coupled receptors in airway smooth muscle" ppsx

... concentration than GDP This exchange of the G- protein- bound GDP for GTP induces a conformational change in the switch region of G and causes the dissociation of G from the G γ dimer The G and G subunits ... [39,226–231] Gs Gq RLXN, Cyt, GI CXN CLT1R ET-A/B EDG 1–7 EP2 H1 histamine IP Prostacyclin [232–236] [237–242] [38,243–245] [20,246,247] [248,249] [41,250] Gq Gq Gq, Gi, G1 2/13 Gs Gq Gs CXN, GP CXN, GP GS, ... novel mitogenic signaling events and define cooperativity between GPCRs and receptor tyrosine kinases in mediating ASM growth G1 2/13 coupled receptors Signaling via activation of the G1 2/13 family...

Ngày tải lên: 13/08/2014, 13:20

23 363 0
CHARACTERIZATION OF g PROTEIN COUPLED RECEPTORS THROUGH THE USE OF BIO  AND CHEMO  INFORMATICS TOOLS

CHARACTERIZATION OF g PROTEIN COUPLED RECEPTORS THROUGH THE USE OF BIO AND CHEMO INFORMATICS TOOLS

... modeling of GPCRs at different activation states automatic modeling of GPCRs at different activation states, and docking odorant ligands II WEB-BASED SERVER FOR AUTOMATICALLY HOMOLOGY MODELING AND ... the ligands AutoDock Vina is a new open-source program for drug discovery, molecular docking and virtual screening, offering multi-core capability, high performance and enhanced accuracy and ease ... CHARACTERIZATION OF G PROTEIN COUPLED RECEPTORS 47 Fig The lowest Autodock VINA affinity of docked ligands generated by the receptor built by template 3rze, although their DOPE and GA341 scores are...

Ngày tải lên: 31/10/2015, 10:39

7 298 0
Báo cáo khoa học: Allosteric functioning of dimeric class C G-protein-coupled receptors doc

Báo cáo khoa học: Allosteric functioning of dimeric class C G-protein-coupled receptors doc

... Class C G- protein- coupled receptors ligand binding This led to the demonstration that most GPCRs can oligomerize as shown by both biochemical and energy transfer technologies [3] In recent ... occurs in the GABAB receptor, GABA binding in the GABAB1 VFT leading to activation of the GABAB2 HD Although GABAB1 VFT binds the agonist and the GABAB2 HD couples to G- protein, a chimeric construct ... of class C GPCRs as well as the C-terminal tail are involved in G- protein coupling For various class C GPCRs, including the mGlu5, GABAB2 and CaS receptors, the HD can fold correctly and be trafficked...

Ngày tải lên: 07/03/2014, 21:20

9 315 0
Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc

Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc

... (2002) G- proteincoupled receptor oligomerization and its potential for drug discovery Nature Rev Drug Discovery 1, 808–820 12 Milligan G (2004) G protein- coupled receptor dimerization: function and ... signal was obtained with increasing energy acceptor ⁄ energy donor ratios Saturation curves so generated resemble ligand ⁄ GPCR binding curves and, as such, the ratio of energy acceptor ⁄ energy ... (2000) Oligomerization of l- and d-opioid receptors J Biol Chem 275, 26128–26135 57 Devi LA (2001) Heterodimerization of G- protein- coupled receptors: pharmacology, signaling and trafficking Trends...

Ngày tải lên: 16/03/2014, 22:20

12 337 0
báo cáo khoa học: " Nucleoside conjugates of quantum dots for characterization of G protein-coupled receptors: strategies for immobilizing A2A adenosine receptor agonists" pdf

báo cáo khoa học: " Nucleoside conjugates of quantum dots for characterization of G protein-coupled receptors: strategies for immobilizing A2A adenosine receptor agonists" pdf

... native ligand is a small molecule Previously, peptide ligands and small neurotransmitter-like molecules were coupled to QDs resulting in specific interactions with the target receptors and drug transporters ... using covalently tethered nucleoside agonist ligands Various approaches to the linking chemistry and the nature of the spacer group and solubilizing groups were compared The QD nucleoside conjugates ... affinity depended greatly on the type of coating and covalent linkage to the QD Conjugates tethered as monovalent attachments through amide-linked chains and PEG dis- Figure General design features...

Ngày tải lên: 11/08/2014, 00:22

19 194 0
Báo cáo khoa học: Activation of nematode G protein GOA-1 by the human muscarinic acetylcholine receptor M2 subtype Functional coupling of G-protein-coupled receptor and G protein originated from evolutionarily distant animals doc

Báo cáo khoa học: Activation of nematode G protein GOA-1 by the human muscarinic acetylcholine receptor M2 subtype Functional coupling of G-protein-coupled receptor and G protein originated from evolutionarily distant animals doc

... following primers: M2-goa1-s, 5¢-CATTATAAGA ACATAGGCGCTACAAGGATGGGTTGTACCATGTC ACAGGAAG-3¢; M2-goa1-PstI-as, 5¢-CCAATGCATTGG TTCTGCAGTTAATACAAGCCGCATCCACGAAGA-3¢ (An engineered PstI recognition ... conditions Human GPCR activates nematode G protein construct, pPAK-M2–Gai1 [25], as a template with the following primers: M2-myc-EcoRI-s, 5¢-CAGAATTCatg gagcagaagctgatctccgaggaggacctgctgGTGAACAACTCCAC ... 1986 [23] Although Gb and Gc are essential for Ga activation by GPCR [10], GPCR can activate Ga without Gb and Gc in some GPCR::Ga fusion proteins [24] Muscarinic-agonist-dependent Ga activation...

Ngày tải lên: 07/03/2014, 11:20

9 400 0
Báo cáo khoa học: G protein-coupled receptor-induced Akt activity in cellular proliferation and apoptosis pptx

Báo cáo khoa học: G protein-coupled receptor-induced Akt activity in cellular proliferation and apoptosis pptx

... either through matrix metalloproteinases (Gi ⁄ o-, Gq-, and Gs -coupled receptors) or through Rho ⁄ Rho-associated kinase (Rock)-mediated expression of RTK ligands (G1 2 ⁄ 13 -coupled receptors) ... activation G1 2 ⁄ 13-, Gi ⁄ o-, Gq-, and Gs -coupled receptors are all known to activate the phosphoinositide 3-kinase (PI3K) ⁄ Akt pathway through either Ga or Gbc subunits Gaq and Gas subunits ... depression and pain [18] GPCRs preferentially couple to heterotrimeric G proteins (consisting of a, b and c subunits) that are grouped into four classes, known as Gaq ⁄ 11, Gai ⁄ o, Gas and Ga12 ⁄...

Ngày tải lên: 16/03/2014, 05:20

12 392 0
Báo cáo khoa học: G protein-coupled receptor 30 down-regulates cofactor expression and interferes with the transcriptional activity of glucocorticoid pdf

Báo cáo khoa học: G protein-coupled receptor 30 down-regulates cofactor expression and interferes with the transcriptional activity of glucocorticoid pdf

... following primers were used for cloning at the pLEGFP-N1 vector: GPR30-forward 5¢-TAATAAGTCGACGGGTC TCTTCCT-3¢ and GPR30-reverse 5¢-ATTATTGGATC CTACACGGCACTGC-3¢ Viruses capable of introducing pLEGFP-N1, ... 5¢-ATCTCCAAGGCAA GATCA-3¢ and reverse primer 5¢-GTGCCATCAGA CAAGGAA-3¢ were used Primer pair resulted in a PCR product of 216 bp Additionally, forward primer 5¢-GAGCCCCAAGAAGAAAGA-3¢ and reverse ... or anti-b-actin (Sigma) Peroxidase-conjugated goat anti-rabbit IgG (Cappel, West Chester, PA, USA) for GR and peroxidase-conjugated goat anti-mouse IgG (Cappel) for PR, ER and b-actin were used...

Ngày tải lên: 16/03/2014, 18:20

10 389 0
Báo cáo khoa học: The impact of G-protein-coupled receptor hetero-oligomerization on function and pharmacology pptx

Báo cáo khoa học: The impact of G-protein-coupled receptor hetero-oligomerization on function and pharmacology pptx

... may form hetero-oligomers [5] The same phenomenon has been shown to occur in hetero-oligomers formed by Gi -coupled and Gq -coupled receptors [6] and by Gs -coupled and Gq -coupled receptors [7] One ... activate a G- protein, leaving their coupling efficacy unchanged For instance, b2-adrenergic receptors, which are coupled with stimulatory G- proteins, and d-opioid and j-opioid receptors, which are coupled ... interaction and ERK1 ⁄ signaling is shown in Fig Regardless of the mechanism by which b -arrestins bind to GPCRs, the signaling pathway activated by these proteins is another way by which GPCR heterooligomerization...

Ngày tải lên: 16/03/2014, 22:20

8 489 0
Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc

Báo cáo khoa học: The study of G-protein coupled receptor oligomerization with computational modeling and bioinformatics doc

... Vriend G (2003) Sequence analysis reveals how G protein- coupled receptors transduce the signal to the G protein Proteins 52, 553–560 Madabushi S, Gross AK, Philippi A, Meng EC, Wensel TG & Lichtarge ... structure of G- protein- coupled receptors J Med Chem 40, 3871–3886 Gouldson PR, Snell CR, Bywater RP, Higgs C & Reynolds CA (1998) Domain swapping in G- protein coupled receptor dimers Prot Eng 11, 1181–1193 ... 1181–1193 Gouldson PR, Higgs C, Smith RE, Dean MK, Gkoutos GV & Reynolds CA (2000) Dimerization and domain swapping in G- protein- coupled receptors: a computational study Neuropsychopharmacology 23,...

Ngày tải lên: 16/03/2014, 22:20

13 516 0
Báo cáo khoa học: The variable C-terminal extension of G-protein-coupled receptor kinase 6 constitutes an accessorial autoregulatory domain ppt

Báo cáo khoa học: The variable C-terminal extension of G-protein-coupled receptor kinase 6 constitutes an accessorial autoregulatory domain ppt

... P2, 5¢-ACTGTCGCTGGAGTTCCCAGAGGAATCTTGG CG-3¢ (nucleotides 1677–1709, antisense) Complementary DNAs encoding the C-terminal mGRK6-A mutants M2 and M3 were prepared either from the mGRK6-A mutant ... (nucleotides 1–26, sense, initiating ATG underlined) in combination with antisense primers introducing a stop codon sequence: mGRK6-A M2: P2, 5¢-CTAGTCGC TGGAGTTCCCAGAGGAATCTTGGCG-3¢ (nucleotides 1677–1706, ... proteins were visualized by SDS ⁄ PAGE and autoradiography of the gel Miscellaneous Protein concentrations were determined according to Bradford [44] using bovine IgG as standard SDS ⁄ PAGE and...

Ngày tải lên: 07/03/2014, 12:20

13 424 0
Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

... venom, mimics receptors by activating GTP-binding regulatory proteins (G proteins) J Biol Chem 263, 6491–6494 19 Haga, K., Ogawa, H., Haga, T & Murofushi, H (1998) GTPbinding -protein- coupled receptor ... EQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL-OH EPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARA EEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSK KSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETR ... KSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETR KAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEEGEMY EDDDEESEAQGPK-OH NEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA-OH PEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA-OH EQFAEEFFAADVESFLNEYGLLPEREIHDLGQTNTEDEDIE-OH...

Ngày tải lên: 17/03/2014, 09:20

10 267 0
Báo cáo Y học: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells pot

Báo cáo Y học: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells pot

... following primers (Amersham Pharmacia Biotech) were used for PCR: GPR30-forward, 5¢-AGTCGG ATGTGAGGTTCAG-3¢; GPR30-reverse, 5¢-TCTGTGT GAGGAGTGCAAG-3¢; TBP-forward, 5¢-TTTGGAAG AGCAACAAAGG-3¢; ... AGCAACAAAGG-3¢; TBP-reverse, 5¢-AAGGGTGCAG TTGTGAGAG-3¢ TBP was used to normalize the RNA samples These primer pairs result in PCR products of 240 bp (GPR30) and 243 bp (TBP) LightCycler data were quantitatively ... tissues [12–14], and some G protein- coupled receptors are known to be involved in growth regulation The regulation of GPR30 expression in MCF-7 cells was progestin specific and was not upregulated by...

Ngày tải lên: 24/03/2014, 00:21

6 425 0
Báo cáo sinh học: " Kaposi''''s sarcoma associated herpesvirus G-protein coupled receptor activation of cyclooxygenase-2 in vascular endothelial ce" pptx

Báo cáo sinh học: " Kaposi''''s sarcoma associated herpesvirus G-protein coupled receptor activation of cyclooxygenase-2 in vascular endothelial ce" pptx

... EcoRI digested pcDNA3 (Invitrogen) using T4 DNA Ligase (Invitrogen) pBABE-GFP and pBABE-GFP-vGPCR were propagated in Escherichia coli strain STBL2 (Invitrogen), whereas pcDNA3-vGPCR, pcDNA3, and ... Virology, Baltimore, MD) by BglII and EcoRI digestion [12] The digested vGPCR fragment was separated by gel electrophoresis, purified using QIAquick PCR Purification Kit (Qiagen, Page of (page number ... KSHV G- protein- coupled receptor (vGPCR) is a constitutively active lytic phase protein with significant homology to the human interleukin-8 (IL-8) receptor and has angiogenic and tumorigenic...

Ngày tải lên: 18/06/2014, 18:20

9 458 0
Báo cáo hóa học: " Kaposi''''s sarcoma associated herpesvirus G-protein coupled receptor activation of cyclooxygenase-2 in vascular endothelial cells" ppt

Báo cáo hóa học: " Kaposi''''s sarcoma associated herpesvirus G-protein coupled receptor activation of cyclooxygenase-2 in vascular endothelial cells" ppt

... EcoRI digested pcDNA3 (Invitrogen) using T4 DNA Ligase (Invitrogen) pBABE-GFP and pBABE-GFP-vGPCR were propagated in Escherichia coli strain STBL2 (Invitrogen), whereas pcDNA3-vGPCR, pcDNA3, and ... Virology, Baltimore, MD) by BglII and EcoRI digestion [12] The digested vGPCR fragment was separated by gel electrophoresis, purified using QIAquick PCR Purification Kit (Qiagen, Page of (page number ... KSHV G- protein- coupled receptor (vGPCR) is a constitutively active lytic phase protein with significant homology to the human interleukin-8 (IL-8) receptor and has angiogenic and tumorigenic...

Ngày tải lên: 20/06/2014, 01:20

9 328 0
Báo cáo y học: "Novel G-protein-coupled receptor-like proteins in the plant pathogenic fungus Magnaporthe grisea" pot

Báo cáo y học: "Novel G-protein-coupled receptor-like proteins in the plant pathogenic fungus Magnaporthe grisea" pot

... TPIAESIAVYVFGALIYASKIPERWYPGCFDYFGGSHNLWHLAVLGGIVFHYIAMQE GLSASGFLPIFQIWLTRGGMSVWEHY SPILESLFVYFLGALVYASKVPERWCPGMFDYVGGSHNLWHMAVLGGILFHYNAMQE GLGASLFLPLAHGLSVLGWKRLDAAMGLESFLGLAAINFSGSAVYAMRIPERWFPGTFDLIGQSHNWMHVLVLTGALVRLNGLIR ... EFSFWGQIYGYLSAILYLGSRLPQLLLNFRRKSTEGVSMLFFLFACLGNLTYVLSILAYDGS -SECAAGPGDCEDGEPGQ -EFNILGQVFGWLCAVLYLGSRVPQILLNYRRKSTEGVSMLFFLFACLGNLTYVLSIFAFEPRCRDKHSGIGPHAGGCVGGEAGR SQEPQAVIGMILGYFSAVCYLCARIPQIIKNYREKSCEGLALLFFLLSLTGNLTYGASVIAY ... GLGASLFLPLAHGLSVLGWKRLDAAMGLESFLGLAAINFSGSAVYAMRIPERWFPGTFDLIGQSHNWMHVLVLTGALVRLNGLIR GLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSN GLGLSGVVPVVHAVGEDGFAALDERMGLKWVMLQGAMYIFGAFIYAARWPERSFPGKFDIWCSSHQIFHIFVLLAAASHLYGMIK...

Ngày tải lên: 14/08/2014, 14:21

14 242 0
Tài liệu Báo cáo khoa học: Regulators of G-protein signalling are modulated by bacterial lipopeptides and lipopolysaccharide pptx

Tài liệu Báo cáo khoa học: Regulators of G-protein signalling are modulated by bacterial lipopeptides and lipopolysaccharide pptx

... MasterPlus SYBR Green I mix (Roche Diagnostics) The following primers were used: muRGS1 5¢-TCTGCTAGCCCAAAGGATTC-3¢ (sense), 5¢TTCACGTCCATTCCAAAAGTC-3¢ (anti-sense); muRGS2 5¢-GAGAAAATGAAGCGGACACTCT-3¢ ... 5¢-GAGAAAATGAAGCGGACACTCT-3¢ (sense), 5¢-TTG CCAGTTTTGGGCTTC-3¢ (antisense); muHPRT as housekeeping gene 5¢-ACTTTGCTTTCCCTGGTTA-3¢ (sense), 5¢-CAAAGTCTGGCCTGTATCC-3¢ (antisense); muTNF-a 5¢-GACCCTCACACTCAGATCATCTTC-3¢ (sense), ... studies have shown that RGS proteins have GTPase activity and act as a GTPase activating protein (GAP) As a result, RGS proteins enhance GTP hydrolysis rates for purified Gai and Gaq subunits as much...

Ngày tải lên: 18/02/2014, 13:20

11 569 0
Báo cáo khoa học: Ion-binding properties of Calnuc, Ca2+ versus Mg2+ – Calnuc adopts additional and unusual Ca2+-binding sites upon interaction with G-protein pdf

Báo cáo khoa học: Ion-binding properties of Calnuc, Ca2+ versus Mg2+ – Calnuc adopts additional and unusual Ca2+-binding sites upon interaction with G-protein pdf

... among all the organelles, the Golgi bodies seem to show an abundance of G- proteins, involved in their biogenesis, trafficking, membrane organization, and many other important functions [16–19] G- proteins ... calcium ions is an emerging and interesting area for investigation In view of these observations, interactions between the Ca2+-binding protein Calnuc and signaling molecule G- proteins assume extreme ... binding of Mg2+ could not be detected Both Ca2+ and Mg2+ caused structural changes in the protein, to varying extents Studies on the protein protein 2530 interaction between Calnuc and G- protein...

Ngày tải lên: 07/03/2014, 00:20

18 333 0
Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

... Chillakuri et al Precoupled form of human CB1 and G protein trimer G CB1(417) +G Anti-Flag M2 IgG Receptor Anti-His tag IgG Receptor Anti-His tag IgG G Anti-Gi1/Gi2 IgG G containing only G proteins did ... restriction sites, was 5¢-GAA T GC GGC CGC TCA CTT TTC GAA TTG AGG GTG CGA CCA GAA TTC AGC CTC GGC AGA CGT GTC TGT GGA-3¢, which contains the StrepII tag between the EcoRI and NotI sites The reverse ... primer for the CB1 gene with the BamHI restriction site was 5¢-GC G GAT CC G ACC ATG GCG AAG TCG ATC CTA GAT GGC-3¢ The reverse primer for the full-length CB1 gene, with EcoRI and NotI restriction...

Ngày tải lên: 23/03/2014, 07:20

10 313 0
Báo cáo khoa học: Alanine screening of the intracellular loops of the human bradykinin B2 receptor – effects on receptor maintenance, G protein activation and internalization pdf

Báo cáo khoa học: Alanine screening of the intracellular loops of the human bradykinin B2 receptor – effects on receptor maintenance, G protein activation and internalization pdf

... tag (MGRSHHHHHHGYPYDVPDYAGS), with the last two amino acids (Gly-Ser) of the tag being generated by the insertion of a BamHI site A few constructs were tagged with a single HA tag (MGYPYDVPDYAGS) ... Ala screening of intracellular loops of the B2 receptor A Faussner et al G protein- coupled receptors (GPCRs), and has been shown to be coupled preferably to G protein Gq ⁄ 11 Following activation, ... synthesized by Invitrogen and delivered desalted and lyophilized Gene mutagenesis, expression and cell culture Standard PCR techniques with primers designed accordingly and the B2Rwt gene as template...

Ngày tải lên: 29/03/2014, 23:20

13 322 0
w