ĐẠI HỌC ĐÀ NẴNG TRƢỜNG ĐẠI HỌC SƢ PHẠM KHOA SINH MƠI TRƢỜNG KHĨA LUẬN TỐT NGHIỆP NGHIÊN CỨU CẢI THIỆN MỨC ĐỘ BIỂU HIỆN CỦA LACCASE TÁI TỔ HỢP TRONG NẤM MEN PICHIA PASTORIS LÊ THỊ KIM THOA Đà Nẵng, năm, 2020 i ĐẠI HỌC ĐÀ NẴNG TRƢỜNG ĐẠI HỌC SƢ PHẠM KHOA SINH MƠI TRƢỜNG KHĨA LUẬN TỐT NGHIỆP NGHIÊN CỨU CẢI THIỆN MỨC ĐỘ BIỂU HIỆN CỦA LACCASE TÁI TỔ HỢP TRONG NẤM MEN PICHIA PASTORIS Ngành: Cơng nghệ sinh học Khóa: 2016 -2020 Sinh viên: Lê Thị Kim Thoa Ngƣời hƣớng dẫn: TS Nguyễn Đức Huy ThS Vũ Đức Hoàng Đà Nẵng,ii năm 2020 LỜI CAM ĐOAN Tơi cam đoan liệu trình bày khóa luận trung thực Đây kết nghiên cứu tác giả chưa công bố cơng trình khác trước Tơi hồn tồn chịu trách nhiệm vi phạm quy định đạo đức khoa học Sinh viên Lê Thị Kim Thoa i LỜI CẢM ƠN Để hoàn thành tốt khóa luận tốt nghiệp này, tơi xin bày tỏ lòng biết ơn chân thành đến TS Nguyễn Đức Huy ThS Vũ Đức Hồng tận tình giúp đỡ, tạo điều kiện tốt suốt trình thực hồn thành khóa luận Đặc biệt, xin chân thành cảm ơn ThS Lê Mỹ Tiểu Ngọc kỹ sƣ Nguyễn Chính Thành, ngƣời trực tiếp hƣớng dẫn cho tơi, tận tình giúp đỡ tơi q trình nghiên cứu Đồng thời, tơi vơ biết ơn tất anh chị nhân viên, bạn sinh viên thuộc Phịng thí nghiệm cơng nghệ enzyme protein, Phịng thí nghiệm Cơng nghệ gen Viện Công nghệ sinh học, Đại học Huế quan tâm, giúp đỡ bảo tận tình cho tơi suốt q trình hồn thành khóa luận tốt nghiệp Ngồi ra, tơi nhận đƣợc giúp đỡ nhiệt tình thầy giáo Khoa Sinh – Môi trƣờng, Trƣờng đại học Sƣ phạm, Đại học Đà Nẵng tạo điều kiện tốt để thực đề tài Tôi xin chân thành cảm ơn Cuối cùng, tơi xin bày tỏ lịng biết ơn sâu sắc đến gia đình, ngƣời thân mình, tập thể bạn lớp 16CNSH khích lệ, động viên tinh thần cho suốt thời gian học tập làm việc Trong trình làm việc, bƣớc đầu làm quen với chun mơn mắc nhiều sai sót, tơi cố gắng rút kinh nghiệm, tìm tịi học hỏi để ngày trƣởng thành Tôi xin chân thành cảm ơn! Đà Nẵng, ngày tháng năm 2020 Sinh viên Lê Thị Kim Thoa ii MỤC LỤC LỜI CAM ĐOAN .i LỜI CẢM ƠN ii MỤC LỤC iii DANH MỤC CÁC CHỮ VIẾT TẮT .vi DANH MỤC BẢNG BIỂU vii DANH MỤC HÌNH ẢNH viii TÓM TẮT .ix MỞ ĐẦU 1 TÍNH CẤP THIẾT ĐỀ TÀI MỤC TIÊU ĐỀ TÀI Ý NGHĨA CỦA ĐỀ TÀI NỘI DUNG NGHIÊN CỨU CHƢƠNG TỔNG QUAN TÀI LIỆU 1.1 TỔNG QUAN VỀ LACCASE 1.1.1 Giới thiệu laccase 1.1.2 Cấu tạo laccase 1.1.3 Cơ chế xúc tác laccase 1.1.4 Đặc tính hóa sinh laccase 1.1.5 Một số yếu tố ảnh hƣởng đến biểu hoạt tính laccase 1.1.6 Nguồn thu nhận laccase 1.1.7 Laccase từ Fusarium oxysporum 10 1.1.8 Ứng dụng laccase 11 1.2 TỔNG QUAN VỀ HỆ THỐNG NẤM MEN PICHIA PASTORIS BIỂU HIỆN PROTEIN NGOẠI LAI 15 1.2.1 Giới thiệu hệ thống biểu nấm men 15 1.2.2 Đặc điểm hệ thống nấm men Pichia pastoris 16 1.2.3 Ƣu điểm nhƣợc điểm hệ thống biểu Pichia pastoris 19 1.3 TỐI ƢU HÓA HỆ THỐNG BIỂU HIỆN PICHIA PASTORIS 20 1.3.1 Thời gian cảm ứng protein ngoại lai nấm men P pastoris 21 1.3.2 Môi trƣờng lên men nhân sinh khối 21 iii 1.3.3 Mật độ tế bào 23 1.3.4 Chất cảm ứng methanol 23 1.3.5 Nhiệt độ nuôi cấy 24 1.4 TỐI ƢU HĨA QUY TRÌNH BIỂU HIỆN PICHIA PASTORIS 24 1.4.1 Nhiệt độ cảm ứng 25 1.4.2 Độ pH cảm ứng 25 1.4.3 Ion kim loại 26 1.5 TÌNH HÌNH NGHIÊN CỨU VỀ LACCASE 27 1.5.1 Một số nghiên cứu nƣớc 27 1.5.2 Một số nghiên cứu giới 29 CHƢƠNG VẬT LIỆU VÀ PHƢƠNG PHÁP NGHIÊN CỨU 42 2.1 VẬT LIỆU NGHIÊN CỨU 32 2.2 PHƢƠNG PHÁP NGHIÊN CỨU 32 2.2.1 Tách DNA tổng số 32 2.2.2 Điện di gel agarose 32 2.2.3 Khuếch đại PCR 33 2.2.4 Kiểm tra biểu laccase tái tổ hợp 33 2.2.5 Xác định hoạt tính enzyme 34 2.2.6 Khảo sát yếu tố ảnh hƣởng đến biểu laccase tái tổ hợp 35 2.2.7 Tinh protein tái tổ hợp 37 2.2.8 Xác định hàm lƣợng protein tổng số 38 2.2.9 Điện di SDS - PAGE 38 2.2.10 Động học phản ứng enzyme 39 2.2.11 Xử lý số liệu 39 CHƢƠNG KẾT QUẢ VÀ THẢO LUẬN 40 3.1 KIỂM TRA CÁC DÒNG BIẾN NẠP P PASTORIS TÁI TỔ HỢP 40 3.2 CẢI THIỆN SẢN XUẤT LACCASE TÁI TỔ HỢP 42 3.2.1 Ảnh hƣởng thời gian cảm ứng 43 3.2.2 Ảnh hƣởng mật độ tế bào 45 3.2.3 Ảnh hƣởng nồng độ methanol 47 3.2.4 Ảnh hƣởng nhiệt độ nuôi cấy 50 3.2.5 Ảnh hƣởng tốc độ lắc 52 iv 3.3 KẾT QUẢ ĐIỆN DI SDS – PAGE: 53 3.4 ĐỘ TINH SẠCH VÀ HOẠT TÍNH LACCASE 54 3.5 MỘT SỐ ĐẶC TÍNH LÝ HÓA CỦA LACCASE TÁI TỔ HỢP 55 3.5.1 Ảnh hƣởng độ pH đến enzyme 55 3.5.2 Ảnh hƣởng nhiệt độ lên enzyme 56 3.5.3 Ảnh hƣởng ion kim loại lên enzyme 58 3.5.4 Động học phản ứng enzyme 60 KẾT LUẬN VÀ KIẾN NGHỊ 65 KẾT LUẬN 65 KIẾN NGHỊ 65 PHỤ LỤC 82 v DANH MỤC CÁC CHỮ VIẾT TẮT HAA 3-hydroxyanthranillic acid ABTS 2,2'-azino-bis (3-ethylbenzothiazoline-6-sulphonic acid) bp Base pair cDNA Complementary DNA Cs Cộng DNA Deoxyribonucleic acid DW Deionized water (Nƣớc cất) EP Eppendorf EtOH Ethanol kDa Kilodalton Lac Gen laccase LiP Lignin peroxidase (ligninase) MnP Manganese peroxidase mV Milivon NCBI National Center for Biotechnology Information PCI Phenol: chloroform: isoamylalcohol PCR Polymerase chain reaction (phản ứng chuỗi polymerase) rpm Số vòng quay phút SDS - PAGE Sodium dodecyl sulfate-polyacrylamide gel electrophoresis Unit (đơn vị enzyme) U vi DANH MỤC BẢNG BIỂU Bảng Tên bảng Trang 2.1 Trình tự mồi dùng để khuếch đại gen AOX1 43 2.2 Thành phần gel polyacrylamide 48 3.1 Hoạt độ riêng laccase với chất khác 65 vii DANH MỤC HÌNH ẢNH Hình Tên hình Trang 1.1 Cấu trúc chiều laccase từ Melanocarpus albomyces 13 1.2 Cấu trúc vị trí hoạt động laccase 14 1.3 Các kiểu xúc tác laccase 15 1.4 Phản ứng xúc tác dihydroxyacetophenone 1.5 Vector biểu pPICZα 28 2.1 Đồ thị đƣờng chuẩn hàm lƣợng BSA theo Bradford 47 3.1 Kết biến nạp DNA tái tổ hợp vào nấm men P pastoris X33 50 3.2 Hình ảnh điện DNA tổng số P pastoris mang gen Folac1 51 3.3 Hình ảnh điện di sản phẩm PCR với cặp mồi AOX1 52 3.4 Ảnh hƣởng thời gian biểu lên laccase tái tổ hợp 53 3.5 Ảnh hƣởng mật độ tế bào lên laccase 56 3.6 Ảnh hƣởng nồng độ methanol lên laccase 58 3.7 Ảnh hƣởng nhiệt độ nuôi cấy lên laccase 61 3.8 Ảnh hƣởng tốc độ lắc lên laccase 63 3.9 Kết điện di SDS – PAGE phản ứng laccase với ABTS 64 3.10 Ảnh hƣởng pH lên laccase 66 3.11 Ảnh hƣởng nhiệt độ lên laccase 68 3.12 Ảnh hƣởng ion kim loại lên laccase 69 3.13 Biến đổi vận tốc phản ứng theo nồng độ chất ABTS 71 3.14 Sự xếp chuỗi acid amin đƣợc suy Fusarium oxysporum HUIB02 laccase (PcARA) 72 3.15 Trình tự amino acid Fusarium oxysporum HUIB02 Folac1 73 3.16 chất laccase 2,5- Mơ hình cấu trúc khơng gian chiều Folac1 Fusarium oxysporum HUIB02 viii 24 74 55 Jahic M., Veide A, Charoenrat T., Teeri T and Enfors S O (2006), Process technology for production and recovery of heterologous proteins with Pichia pastoris, Biotechnol Progress, 22 (6): 1465-1473 56 Jahic M., Wallberg F., Bollok M., Garcia P (2003), Enfors Temperature limited fedbatch technique for control of proteolysis in Pichia pastoris bioreactor cultures, Microbial Cell Factories, (1):6 57 Janusz G., Pawlik A., Swiderska-Burek U., Polak J., Sulej J., Jarosz-Wilkolazka A., Paszczynski A (2020), Laccase properties, physiological functions, and evolution, International journal of molecular sciences, 21(3) 58 Jenq H., Chia K., Lisa W K.L P and Chi T L (2015) Molecular cloning and biochemical characterization of laccase from Rigidoporus vinctus, Institute of Marine Biology Periodical Articles, 23(5): 827- 835 59 Jie Y., Wenjuan L., Tzi B N., Xiangzhen D., Juan L and Xiuyun Y (2017), Laccases: Production, Expression Regulation, and Applications in Pharmaceutical Biodegradation, Frontiers in Microbiology, (1): 1-24 60 Jing S., Ri-He P., Ai-Sheng X., Yongsheng T., Wei Z., Hu X., Da-Tong L., JianMin C and Quan-Hong Y (2012), Secretory expression and characterization of a soluble laccase from the Ganoderma lucidum strain 7071-9 in Pichia pastoris, Molecular Biology Reports, 39(4):3807–3814 61 Johannes C and Majcherczyk A (2000), Natural mediators in the oxidation of polycyclic aromatic hydrocarbons by laccase mediator systems, Applied and Environmental Microbiology, 66(2): 524-528 62 Jorda J., Jesus S.S., Peltier S (2014), Metabolic flux analysis of recombinant Pichia pastoris growing on different glycerol/methanol mixtures by iterative fitting of NMR-derived (13) C-labelling data from proteinogenic amino acids, New Biotechnology, 31(1):120–132 63 Kallio J.P., Gasparetti C., Andberg M., Boer H., Koivula A., Kruus K., Rouvinen J and Hakulinen N (2011), Crystal structure of an ascomycete fungal laccase from Thielavia arenaria-common structural features of asco-laccases, The FEBS journal, 278: (13) 2283-2295 64 Kang H A., Choi E S., Hong W K., Kim J Y., Ko S M and Sohn J H (2000), Proteolytic stability of recombinant human serum albumin secreted in the yeast 72 Saccharomyces cerevisiae, Applied Microbiology and Biotechnology, 53(5): 575–582 65 Karbalaei M., Rezaee S and Farsiani H (2019), Pichia pastoris: A highly successful expression system for optimal synthesis of heterologous proteins, Journal Cellular Physiology, 1–15 66 Kiiskinen L.L (2005), Characteration and heterologuos production of novel laccase from Melanocarpus albomyces, VTT Publications 556 67 Koyanagi T., Matsumura K., Kuroda S and Tanizawa K (2000), Molecular cloning and heterologous expression of pea seedling copper amine oxidase, Bioscience, Biotechnology, and Biochemistry, 64(4):717–722 68 Kumar A and Chandra R (2020), Ligninolytic enzymes and its mechanisms for degradation of lignocellulosic waste in environment, Heliyon, 6: (2) 69 Kunamneni A., Ballesteros A., Plou F.J and Alcalde M (2007), Fungal laccase a versatile enzyme for biotechnological applications, Communicating Current Research and Educational Topics and Trends in Applied Microbiology, Formatex, 1: 233–245 70 Kuntal K., Rohit C., Mohd S and Sarita S (2013), Isolation Of Laccase Producing Trichoderma Sp And Effect Of pH And Temperature On Its Activity, International Journal of ChemTech Research, 5(5): 2229-2235 71 Kuznetsov A B., Shumakovich G P., Koroleva O V and Yaropolov A I (2001), On applicability of laccase as label in the mediated and mediatorless electroimmunoassay: effect of distance on the direct electron transfer between laccase and electrode, Biosensors and Bioelectronics, 16(1 - 2): 73–84 72 Kwiatos N., Ryngajllo M and Bielecki S (2015), Diversity of laccase-coding genes in Fusarium oxysporum genomes, Frontiers in microbiology, 6: 933 73 Laemmli, 1970, Cleavage of structural proteins during the assembly of the head of bacteriophage T4, Nature, 227(5259): 680-685 74 Lantz M S and Ciborowski P (2018), Zymographic techniques for detection and characterization of microbial proteases, Methods in Enzymology, 235(1994): 563-594 73 Academic Press, 75 Li P., Anumanthan A., Gao X G., Ilangovan K., Suzara V V., Duzgunes N and Renugopalakrishnan V (2007), Expression of recombinant proteins in Pichia pastoris, Applied Biochemistry Biotechnology, 142 (2): 105-124 76 Li Q., Peia J., Zhao L., Xie J., Cao F , and Wang G., 2013 Over expression and Characterization of Laccase from Trametes versicolor in Pichia pastoris, Biochemistry and Microbiology, 50(2): 140–147 77 Li Z., Xiong F., Lin Q., 2001 Low-temperature increases the yield of biologically active herring antifreeze protein in Pichia pastoris, Protein Expression and Purification, 21:438-445 78 Lin-Feng Y., Zhi-Ming L., Jun-Fang L., Li-Qiong G., Xun-Liu H and Hai-Xing Y (2013), Molecular cloning of a laccase gene from Ganoderma lucidum and heterologous expression in Pichia pastoris, Journal of Basic Microbiotechnology, 53: 1–8 79 Ling L Y., Ithoi I and Yik F M (2010), Optimization for high-level expression in Pichia pastoris and purification of truncated and full length recombinant sag2 of toxoplasma gondii for diagnostic use, The Southeast Asian Journal of Tropical Medicine and Public Health, 41(3): 507 – 513 80 Liu W., Chao Y., Liu S., Bao H and Qian S., 2003 Molecular cloning and characterization of a laccase gene from the basidiomycete Fome lignosus and expression in Pichia pastoris, Applied Microbiology Biotechnology, 63(2):174– 181 81 Lu L., Zhao M., Liang S C., Zhao L Y., Li D B and Zhang B B (2009), Production and synthetic dyes decolourization capacity of a recombinant laccase from Pichia pastoris, Journal of Applied Microbiology, 107(4): 1149–1156 82 Lyons J I., Newell S Y., Buchan A and Moran M.A (2003), Diversity of ascomycete laccase gene sequences in a southeastern US salt marsh, Microbial Ecology, 45(3): 270–281 83 Madzak C., Mimmi M C., Caminade E., Brault A., Baumberger S., Briozzo P., Mougin C and Jolivalt C (2006), Shifting the optimal pH of activity for a laccase from the fungus Trametes versicolor by structure-based mutagenesis, Protein Engineering, Design and Selection, 19 (2006): 77-84 74 84 Maity N., Thawani A and Sharma A., 2016 Expression and control of codonoptimized granulocyte colony-stimulating factor in Pichia pastoris, Applied Biochemistry Biotechnology, 178(1):159–172 85 Maria C C., Stefania L., Anna M G., Vincenzo B and Maurizio R (2006), Heterologous expression of lcc1 gene from Trametes trogii in Pichia pastoris and characterization of the recombinant enzyme, Microbial Cell Factories, 5(31): 1- 11 86 Matsumoto A A., Akanuma S., Motoi M., Yamagishi A and Ohno N (2014), Cloning and characterization of laccase DNA from the Royal Sun medicinal mushroom, Agaricus brasiliensis higher Basidiomycetes, International Journal of Medicinal Mushrooms, 16(4): 375-393 87 Mayolo-Deloisa K., Gonzalez-Gonzalez M., Rito-Palomares M (2020), Laccases in food industry: Bioprocessing, potential industrial and biotechnological applications, Frontiers in bioengineering and biotechnology, 8: 222 88 Mei G., Fuping L., Lianxiang D., Jun P and Dongqing B (2006), Optimization of the expression of a laccase gene from Trametes versicolor in Pichia methanolica, Applied Microbiology Biotechnology, 71(6): 848–852 89 Meza J C., Auria R., Lomascolo A., Sigoillot J C and Casalot L (2007), Role of ethanol on growth, laccase production and protease activity in Pycnoporus cinnabarinus ss3, Enzyme and Microbial Technology, 41(1 - 2): 162 - 168 90 Miao Z., Chi Y., Hong Y and Shao S (2013), Decolorization of Alizarin Red and other synthetic dyes by a recombinant laccase from Pichia pastoris, Biotechnology Letter, 36(1): 39 – 45 91 Michael R., Carol S and Jeffrey C (1992), Foreign gene expression in Yeast: a review, Department of Cell Biology, Wellcome Research Laboratories, Beckenham, Kent BR3 3BS, U.K 92 Michielse C.B., Rep M (2009), Pathogen profile update: Fusarium oxysporum, Molecular Plant Pathology, 10(3): 311-324 93 Mike Romanos, (1995), Advances in the use of Pichia pastoris for high level gen expression, Current Opinion in Biotechnology, 6(5): 527-533 75 94 Minning S., Serrano A., Ferrer P., Sola C , Schmid R., Valero F (2001), Optimization of the high-level production of Rhizopus oryzae lipase in Pichia pastoris, Journal of Biotechnology, 86(2001): 59 – 70 95 Minsa P., Minseek K., Sinil K., Byeongsuk H and Hyeon S R (2015), Differential Expression of Laccase Genes in Pleurotus ostreatus and Biochemical Characterization of Laccase Isozymes Produced in Pichia pastoris, Mycobiology, 43(30): 280-287 96 Minussi R C, Miranda M A and Silva J A (2007), Purification, characterization and application of laccase from Trametes versicolor for colour and phenolic removal of olive mill wastewater in the presence of 1-hydroxybenzotriazole African Journal of Biotechnology, 6(10): 1248–1254 97 Monssef R A A E., Hassan E A., Ramadan E M (2016), Production of laccase enzyme for their potential application to decolorize fungal pigments on aging paper and parchment, Annals of Agricultural Science, 61(1): 145 – 154 98 Morozova O V., Shumakovich G P., Shleev S V and Yaropolov Y I (2007), Laccase-mediator systems and their applications: A review, Applied Biochemistry And Microbiotechnology, 43(5): 523–535 99 Morsi R., Bilal M., Iqbal H M N., Ashraf S S (2020), Laccases and peroxidases: The smart, greener and futuristic biocatalytic tools to mitigate recalcitrant emerging pollutants, The Science of the total environment, 714: 136572 100 Murasugi A and Tohma Y (2003), Production of native recombinant human midkine in the yeast, Pichia pastoris, Protein Expression and Purification, 27 (2): 244-252 101 Nakagawa T., Wakayama K and Hayakawa T (2015), Selection of suitably nonrepressing carbon sources for expression of alcohol oxidase isozyme promoters in the methylotrophic yeast Pichia methanolic, Journal of Bioscience Bioengineering, 120(1):41–44 102 Neha G., Nora B., Tenzin K., Meenu C., Marion A.S and Saroj M (2012), Cloning, sequence analysis, expression of Cyathus bulleri laccase in Pichia pastoris and characterization of recombinant laccase, BMC Biotechnology, 12(1):75 76 103 Nevitt T., Ohrvik H and Thiele D.J (2012), Charting the travels of copper in eukaryotes from yeast to mammals, Biochimica et Biophysica Acta, 1823(9):1586–1593 104 Nielsen H (2017), Predicting Secretory Proteins with SignalP, Methods in molecular biology, Humana Press, 1611: 59-73 105 Nisha G., Korrapati N and Pydisetty (2018), Biochemical and kinetic characterization of laccase and manganese peroxidase from novel Klebsiella pneumoniae strains and their application in bioethanol production, © The Royal Society of Chemistry Journal, 8(8): 15044–15055 106 Nunes C S and Kunamneni A (2018), Chapter – laccases—properties and applications Enzymes, Human and Animal Nutrition, Cambridge, MA: Academic Press, 133–161 107 Orkun P., Candan T and Ayten Y K (2017), Heterologous expression and characterization of a high redox potential laccase from Coriolopsis polyzona MUCL 38443, Turkish Journal of Biology, 41(2): 278-291 108 Palonen H., Saloheimo M., Viikari L and Kruus K (2003), Purification, characterization and sequence analysis of a laccase from the ascomycete Mauginiella sp., Enzyme and Microbial Technology, 33(6): 854–862 109 Parshetti G K., Kalme S.D., Gomare S.S and Govindwar S.P (2007), Biodegradation of Reactive blue - 25 by Aspergillus ochraceus NCIM–1146 Bioresource technology, 98(18): 3638-3642 110 Pingzuo L., Anukanth A., Xiu – Gong G., Kuppusamy I., Vincent V S., Nejat D and Renugopalakrishnan V (2007), Expression of Recombinat Proteins in Pichia Pastoris, Applied Biochemistry Biotechnology, 142 (2): 105 – 124 111 Piontek K., Antorini M and Choinowski T (2002), Crystal Structure of a Laccase from the Fungus Trametes versicolor at 1.90-Å Resolution Containing a Full Complement of Coppers, The Journal Of Biological Chemistry, 277(40): 37663–37669 112 Plantz B A., Sinha J., Villarete L., Nickerson K and Schlegel V L (2006), Pichia pastoris fermentation process optimization: Energy state and testing a growth associated model, Applied Microbiology Biotechnology, 72(2): 297-305 77 113 Plantz B.A., Nickerson K., Kachman S.D and Schlegel V.L (2007), Evaluation of metals in a defined medium for Pichia pastoris expressing recombinant βgalactosidase, Biotechnology Progress, 23:687–692 114 Rabert D., Weinacker A., Pessoa Jr., Farías F J (2013), Recombinants proteins for industrial uses: utilization of Pichia pastoris expression system, Brazillian of Journal Microbiology, 44 (2):351-356 115 Record E., Punt P J., Chamkha M., Labat M., Hondel C A M J J V D and Asther M., Expression of the Pycnoporus cinnabarinus laccase gene in Aspergillus niger and characterization of the recombinant enzym, European Journal of Biochemistry, 269 (2002): 602-609 116 Reyes-Medina M.A., Macias-Sanchez K.L (2015), GTPase Rho1 regulates the expression of xyl3 and laccase genes in Fusarium oxysporum, Biotechnology Lettẻ, 37(3): 679-683 117 Rodr´ıguez C S., Sanroman M and Gubitz G M (2005), Influence of redox mediators and metal ions on synthetic acid dye decolourization by crude laccase from Trametes hirsuta, Chemosphere, 58(4): 417–422 118 Santhanam N., Vivanco J.M and Decker S (2011), Expression of industrially relevant laccases: prokaryotic style, Trends in Biotechnology, 480-489 119 Santoso A., Herawati N and Rubiana Y (2012), Effect of methanol induction and incubation time on expression of human erythropoietin in methylotropic yeast Pichia pastoris, Makara Journal of Technology, 16(1): 29–34 120 Schlosser D and Hofer C (2002), Laccase catalyzed oxidation of Mn2+ in the presence of natural Mn3+ chelators as a novel source of extracellular H2O2 production and its impact on manganese peroxidase, Applied and Environmental Microbiology, 68: 3514–3521 121 Schneider P and Mondorf K (1999), Characterization of a Coprinus cinereus laccase, Enzyme and Microbial Technology, 25: 502-508 122 Sergio R (2006), Laccase: blue enzymes for gree chemistry, Trends in Biotechnology, 24 (5): 219 - 226 123 Sheikhi F., Ardakani M R., Enayatizamir N and Rodriguez-Couto S (2012), The determination of assay for laccase of Bacillus subtilis wpi with two classes 78 of chemical compounds as substrates, Indian Journal Microbiology, 54(4): 701 – 707 124 Shi X., Karkut T., Chamankhah M., Alting-Mees M., Hemmingsen S M and Hegedus D (2003), Optimal conditions for the expression of a single-chain antibody (scFv) gene in Pichia pastoris, Protein Expression and Purification, 28(2): 321–330 125 Soden D M., O‘Callaghan J and Dobson, 2002 Molecular cloning of a laccase isozyme gene from Pleurotus sajor-caju and expression in the heterologous Pichia pastoris host, Microbyology, 148(12): 4003- 4014 126 Soden D.M and Dobson A.D.W (2001) Differential regulation of laccase gene expression in Pleurotus sajorcaju, Microbiology and Molecular Biology Reviews, 147(7): 1755–1763 127 Soleimanpour S., Farsiani H., Mosavat A., Ghazvini K., Eydgahi M R A., Sankian M and Rezaee S A (2015), APC targeting enhances immunogenicity of a novel multistage Fc‐fusion tuberculosis vaccine in mice, Applied Microbiology and Biotechnology, 99(24): 10467–10480 128 Stefan S (2000), Basic Techniques in Molecular Biology, - 421 129 Sung J J and Su J L (2017), Purification and Characterization of the Laccase Involved in Dye Decolorization by the White-Rot Fungus Marasmius scorodonius, Microbiology Biotechnology, 27(6): 1120–1127 130 Sunil S., Renuka P S., Pruthvi K., Swetha M., Malini and Veena S M (2011), Isolation, Purification, and Characterization of Fungal Laccase from Pleurotus sp, Microbial Enzyme: Applications in Industry and in Bioremediation, 2011: 17 131 Suresh P.S., Kumar A., Kumar R and Singh V.P (2008), An Insilco approach to bioremediation: laccase as a case study, Journal of Molecular Graphics and Modelling, 26(5): 845–849 132 Tang W., Li Y., Liu L., Zhang J and Xian H (2012), Characterization and production optimization of a chitinase (Tachil) from Trichoderma asperellum in recombinant Pichia pastoris expression system, Wei Sheng Wu Xue Bao, 52(3): 345-352 79 133 Tas P A and Kolankaya N (1988), Optimization of enzymatic chlorine removal from Kraft pulp, Bulletin of Environmental Contamination and Toxicology, 6(1): 15–21 134 Thurson C., 1994 The structure and function of fungal laccases Microbiology and Molecular Biology Reviews 140(1): 19 - 26 135 Tian Y S., Xu H., Peng R.H., Yao Q H and Wang R T (2014), Heterologous expression and characterization of laccase from Coprinopsis cinerea capable of decolourizing different recalcitrant dyes, Biotechnology and Biotechnological Equipment, 28(2): 248 – 258 136 Trimble R B., Atkinson P H., Tschopp J F., Townsend R R and Maley F (1991), Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris, Journal of Biological Chemistry, 266 (34):22807-22817 137 Tschopp J F., Sverlow G., Kosson R., Craig W and Grinna L (1987), HighLevel Secretion of Glycosylated Invertase in the Methylotrophic Yeast, Pichia Pastoris, Biotechnology, New York, 5: 1305–1308 138 Upadhyay P., Shrivastava R and Agrawal P.K (2016), Bioprospecting and biotechnological applications of fungal laccase, Biotechology, (6): - 15 139 Volesky B and May-Phillips H.A (1995), Biosorption of heavy metals by Saccharomyces cerevisiae, Applied Microbiology Biotechnology 42(5):797– 806 140 Wang Y and Yang Q (2009), Cloning and expression of a novel chitinase chi58 from Chaetomium cupreum in Pichia pastoris, Biochemical Genetics, 47(7-8): 547-558 141 Westerholm A., Selinheimo E., Boer H., Kalkkinen N., Mattinen M and Saloheimo M (2007), Expression of the Trichoderma reesei tyrosinase in Pichia pastoris: Isotopic labeling and physicochemical characterization, Protein Expression and Purification, 55(1):147–158 142 Wright A and Morrison S L (1997), Effect of glycosylation on antibody function: implications for genetic engineering, Trends Biotechnology,15(1):2632 80 143 Wu D.C., Qu L.Z and Fu Y (2016), Expression and purification of the kinase domain of PINK1 in Pichia pastoris, Protein Expression and Purification, 128:67–72 144 Xie J., Zhang L and Ye Q (2003), Angiostatin production in cultivation of Pichia pastoris fed with mixed carbon sources, Biotechnololy Letts, 25(2): 173– 177 145 Yaver D.S., Maria D.C.O and Xu F (1999), Molecular characterization of laccase genes from the basidiomycete Coprinus cinereus and heterologous expression of the laccase Lcc1, Applied and Environmental Microbiology, 65(11): 4943-4948 146 Yoshida, H (1883) Chemistry of Lacquer (Urushi) Part 1, Journal of the Chemical Society, 43: 472-486 http://dx.doi.org/10.1039/ct8834300472 147 Zadrazil F., Gonser A and Lang E (1999), Influence of incubation temperature on the secretion of extracellular ligninolytic enzymes of Pleurotus sp and Dichomitus squalens, Journal Basic Microbiology, 40(1): 33 – 39 148 Zamorani A., Spettoli P., Lante A., Crapisi A and Pasini G (1993), Immobilized laccase and tyrosinase: an approach for wine stabilization, Italian Journal of Food Science, 4: 409–414 149 Zhang W., Inan M and Meagher M M (2005), Fermentation strategies for recombinant protein expression in the methylotrophic yeast Pichia pastoris, Biotechnology and Bioprocess Engineering, Spiringer, 5(4):275 – 280 150 Zhao Y., Jiang H., Rao Z., Ji Y., Cheng Y and Ma Y (2015), High level expression of Saccharomyces cerevisiae chitinase (ScCTS1) in Pichia pastoris for degrading chitin, International Journal of Agricultural and Biological Engineering, 8(5): 142-150 81 PHỤ LỤC Bảng 1: YP Môi trƣờng YP rắn Môi trƣờng YP lỏng Yeast extract 10g Yeast extract 10g Pepton 20g Peptone 20g Bacto agar 20g Nƣớc cất 1L Nƣớc cất 1L Bảng 2: Môi trƣờng YPD Môi trƣờng YPD rắn Môi trƣờng YPD lỏng Dextrose 20 g Dextrose 20 g Yeast extract 10 g Yeast extract 10 g Pepton 20 g Peptone 20 g Bacto agar 20 g Nƣớc cất 1L 82 Nƣớc cất 1L Bảng 3: Môi trƣờng YPG lỏng Pepton 20 g Yeast extract 10 g Glycerol 20 ml Nƣớc cất 1L Bảng 4: Thành phần gel polyacrylamide Đệm (Buffer) Thành phần 29 g acrylamide 30% acrylamide solution Bảo quản chai tối 4oC g N,N'-methylenebisacrylamide (bisacrylamide) Dissolve đong 60 ml DW Sau đong đến 100 mL DW 4X separating gel buffer 1.5 M Tris (pH8.8) 0.4 % SDS 4X stacking gel buffer 0.5 M Tris (pH 6.8) 0.4 % SDS M Tris 75 mL + 10% SDS mL Đong đến 100 ml DW (Đệm đƣợc bảo quản tháng 40C) 1 M Tris 50 mL + 10% SDS mL Đong đến 100 ml DW (Đệm đƣợc bảo quản tháng 40C) 10 % ammonium persulfate 1g SDS + 10 ml DW 2× SDS sample buffer 1 M Tris 12.5 mL 0.125 M Tris-Cl (pH 6.8) 4% SDS 20% glycerol 10% 2-mercaptoethanol SDS : g glycerol 20 mL 2-mercaptoethanol : 10 mL bromophenol blue : 0.2 g 83 0.2% bromophenol blue Electrophoresis buffer 0.025 M Tris 0.192 M glycine 0.1 % SDS Đong đến 100 ml DW, bảo quản nhiệt độ phòng Tris g + glycine 14.4 g + SDS g Adjust volume to L DDW Đo pH 8,3 – 8,8 với HCl Coomassie Brilliant Blue R250 : 2.5 g Gel staning solution (1 L) methanol : 450 mL H2O : 450 mL glacial acetic acid : 100 mL methanol : 300 mL Gel destaning solution (1 L) glacial acetic acid : 100 mL H2O : 600 mL Hình 1: Thermo Scientific GeneRuler kb DNA Ladder (Nguồn: https://assets.thermofisher.com/TFS Assets/LSG/manuals/MAN0013004_GeneRuler_1kb_DNALadder_250ug_UG.pdf) 84 Hình 2: Thermo Scientific™ PageRuler™ Prestained Protein Ladder, 10 to 180 kDa (Nguồn: https://www.fishersci.co.uk/shop/products/pageruler-prestained-10-170kda- protein-ladder/11822124) 85 MTKLSLTPFCSLSFTILLKLQGSEPLPKMGFYSACKTFIVYTVTFFSLPF HEHIGGDSEQPVLSFENGQISQNYPKFPAPNGPDSPDEDFTCKYPELGNDWKP CSTPENRHCWLKSSDGHNFSIHTDYETMYPPGVLREYWLVVDNKTINGDGID NPYGKVFNQTYPGLWIKACWGDLIRVHVTNKLRYNGTTIHWHGTRQNGTME MDGVNGVTQCPIAPNDTFTYELRALQYGSSWYHSHYSLQYADGLAGPITIFGP SSAHYDEAKDPILITDWNHRSAFQEWERELTGLPTRPQMNSILMNGIGNFAGS YPRERYNMTVTKGRKYLLRIINTSVDTTFLFSIDNHHFEVMSSDFVPIHPYTVD HILVGIGQRYHVVLHANPRNDTKFPASDNGNYWIRTVPADGCKGFEDGNEPD ERQGILRYEPVSTEVPQTWRGPWNKTCSDEKYENLKPVLPWSIPPVELYSRDK SKDLKLGLQQEKNRPHLGDKFSWWAFGAQPLWLNFSEPTITLLDEKKEWPGD YVIVPAENRGGWVYLVITAPATEELGNNRTFISLAHPLHLHGHDFALLAQGSD SSQIDDPDNPITLKFDNPPRRDVALIPAGGYLIVAFKADNPGSWLFHCHIAWHA SSGLALQIMEREEDLRKMMTPEKLKQVNEGCKKWKDWYGDRKNHWNPVGI FQDDSGV Hình 3: Trình tự amino acid Fusarium oxysporum HUIB02 Folac1 71 ... thực đề tài: ? ?Nghiên cứu cải thiện mức độ biểu laccase nấm men Pichia pastoris tái tổ hợp? ?? Qua q trình thực hiện, chúng tơi kiểm tra thành công gen Folac1 P pastoris Laccase tái tổ hợp đƣợc xác... mức độ biểu laccase nấm men P pastoris tái tổ hợp Ý NGHĨA CỦA ĐỀ TÀI Ý nghĩa khoa học: Cung cấp dẫn liệu khoa học quy trình kiểm tra cải thiện mức độ biểu laccase nấm men P pastoris tái tổ hợp. .. pastoris tái tổ hợp Cải thiện mức độ biểu gen Folac1 tái tổ hợp nấm men P pastoris CHƢƠNG TỔNG QUAN TÀI LIỆU 1.1 TỔNG QUAN VỀ LACCASE 1.1.1 Giới thiệu laccase Laccase số enzyme đƣợc nghiên cứu từ