Phân tích đa hình di truyền và mức độ biểu hiện của gen OsHKT2 4 ở lúa (oryza sativa)

ĐẠI HỌC QUỐC GIA HÀ NỘI TRƢỜNG ĐẠI HỌC KHOA HỌC TỰ NHIÊN - Nguyễn Tiến Đạt PHÂN TÍCH ĐA HÌNH DI TRUYỀN VÀ MỨC ĐỘ BIỂU HIỆN CỦA GEN OsHKT2;4 Ở LÚA (Oryza sativa) LUẬN VĂN THẠC SĨ KHOA HỌC Hà Nội - 2016 ĐẠI HỌC QUỐC GIA HÀ NỘI TRƢỜNG ĐẠI HỌC KHOA HỌC TỰ NHIÊN * * Nguyễn Tiến Đạt PHÂN TÍCH ĐA HÌNH DI TRUYỀN VÀ MỨC ĐỘ BIỂU HIỆN CỦA GEN OsHKT2;4 Ở LÚA (Oryza sativa) Chuyên ngành : Di truyền học Mã số: 60420121 LUẬN VĂN THẠC SĨ KHOA HỌC Cán hƣớng dẫn: TS Đỗ Thị Phúc H Nội LỜI CẢM ƠN Lời đầu tiên, tơi xin bày tỏ lịng biết ơn sâu sắc đến TS Đỗ Thị Phúc, người hướng dẫn, quan tâm tận tình bảo, giúp đỡ tơi suốt trình học tập thực đề tài Cảm ơn cô, người truyền cảm hứng niềm tin cho tơi thí nghiệm, cơng việc Tôi xin gửi lời cảm ơn chân thành tới thầy cô công tác Bộ môn Di truyền học quan tâm tạo điều kiện thuận lợi giúp tơi hồn thành luận văn Các thầy bảo cho tơi cẩn thận, kiên trì nghiêm túc nghiên cứu khoa học Tôi xin gửi lời cảm ơn tới CN Trần Xuân An, CN Phạm Quỳnh Hoa, CN Ngô Thị Hạnh giúp đỡ tơi thí nghiệm Các em ln quan tâm truyền đạt cho kinh nghiệm quý báu thực nghiệm Tôi xin chân thành cảm ơn Phịng Thí nghiệm Trọng điểm Cơng nghệ Protein Enzyme; Học viện Nông nghiệp Việt Nam giúp đỡ tơi nhiều q trình thực đề tài Cuối cùng, xin gửi lời cảm ơn sâu sắc tới gia đình, người thân, người tận tình giúp đỡ, bảo tạo điều kiện tốt để học tập Cảm ơn người động viên, khuyến khích tơi q trình học tập thí nghiệm Hà Nội, tháng 11 năm 2016 Nguyễn Tiến Đạt MỤC LỤC MỞ ĐẦU CHƢƠNG TỔNG QUAN TÀI LIỆU 1.1 Giới thiệu Lúa (Oryza sativa) 1.2 Giới thiệu họ protein vận chuyển ion xuyên màng HKT thực vật lúa 1.2.1 Họ protein HKT thực vật 1.2.2 Họ protein HKT lúa 1.2.3 Gen OsHKT2;4 1.2.4 Tình hình nghiên cứu gen OsHKT2;4 10 1.3 Một số phƣơng pháp nghiên cứu đa hình nucleotide 11 1.3.1 Phƣơng pháp RFLP-PCR 11 1.3.2 Phƣơng pháp giải trình tự 14 1.4 Phƣơng pháp phân tích mức độ biểu gen 16 1.4.1 Lai Northern blot lai huỳnh quang chỗ 16 1.4.2 RT-PCR Real-time PCR 17 1.4.3 Các phƣơng pháp sử dụng chip 19 CHƢƠNG ĐỐI TƢỢNG VÀ PHƢƠNG PHÁP .20 2.1 Đối tƣợng nghiên cứu, hóa chất thiết bị 20 2.1.1 Đối tƣợng nghiên cứu 20 2.1.2 Vật liệu, hóa chất thiết bị 21 2.2 Phƣơng pháp nghiên cứu 22 2.2.1 Các phƣơng pháp sử dụng nghiên cứu đa hình gen OsHKT2;4 22 2.2.2 Các phƣơng pháp sử dụng phân tích biểu gen 25 CHƢƠNG 3.1 KẾT QUẢ VÀ THẢO LUẬN .29 Phân tích đa hình gen Oshkt2;4 lúa 29 3.1.1 Tách chiết DNA tổng số 29 3.1.2 Khuếch đại gen OsHKT2;4 PCR 30 3.1.3 Giải trình tự gen OsHKT2;4 31 3.1.4 Phân tích đa hình gen OsHKT2;4 32 3.2 Phân tích biểu gen 42 3.2.1 Kết trồng lúa thủy canh xử lý mặn 42 3.2.2 Kết tách chiết RNA tổng hợp cDNA 42 3.2.3 Phản ứng Real-time PCR phân tích mức độ biểu gen OsHKT2;4 43 KẾT LUẬN VÀ KIẾN NGHỊ .49 KẾT LUẬN 49 KIẾN NGHỊ 49 TÀI LIỆU THAM KHẢO 50 Phụ lục Phụ lục Phụ lục Phụ lục DANH MỤC BẢNG Bảng 1.1 Các protein họ HKT đƣợc biết Bảng 1.2 Họ gen HKT lúa (Oryza sativa) Bảng 2.1 Các giống lúa nghiên cứu 20 Bảng 2.2 Các cặp mồi đặc hiệu đƣợc sử dụng nghiên cứu 21 Bảng 3.1 Hai nhóm giống lúa phân chia theo đa hình nucleotide 32 Bảng 3.2 Vị trí đa hình nucleotide nhóm 34 Bảng 3.3 Các đa hình amino acid tƣơng ứng với đa hình nucleotide 35 Bảng 3.7 Giá trị Fold change mẫu tách chiết từ giống Nipponbare Pokkali thời điểm 46 DANH MỤC HÌNH Hình 1.1 Cây lúa (Oryza sativa) phận lúa .3 Hình 1.2 Một số chế vận chuyển Na+ hệ thống đáp ứng stress mặn thực vật Hình 1.3 Gen OsHKT2;4 sở liệu Phytozome 10 Hình 1.4 Phƣơng pháp RFLP-PCR sử dụng nghiên cứu di truyền phân tử 13 Hình 1.5 Kỹ thuật giải trình tự phƣơng pháp Sanger cải biến 14 Hình 1.6 Các bƣớc phƣơng pháp Northern blot 17 Hình 1.7 Đồ thị tín hiệu huỳnh quang thu nhận từ máy Real-time PCR 18 Hình 1.8 Sử dụng chip Microarray phân tích biểu 19 Hình 2.1 Các bƣớc thí nghiệm nghiên cứu đa hình gen OsHKT2;4 22 Hình 2.2 Các bƣớc thực thí nghiệm phân tích biểu gen OsHKT2;4 25 Hình 2.3 Trồng lúa thủy canh xử lý mặn .26 Hình 3.1 Kết điện di DNA tổng số tách chiết từ mẫu 14 giống lúa 30 Hình 3.2 Kết điện di sản phẩm PCR khuếch đại vùng gen OsHKT2;4 .30 Hình 3.3 Kết giải trình tự đƣợc phân tích phần mềm Bioedit 31 Hình 3.4 Một phần kết so sánh trình tự cơng cụ MultAlin 33 Hình 3.5 Mơ hình dự đốn cấu trúc bậc ba protein OsHKT2;4 36 Hình 3.6 Phân bố góc quay amino acid mơ hình cấu trúc 3D qua phân tích Ramachandran Plot 37 Hình 3.7 Cấu trúc phân tử amino acid đa hình vị trí 53 253 38 Hình 3.8 Cấu trúc phân tử amino acid đa hình vị trí 342 39 Hình 3.9 Mơ hình dự đoán cấu trúc xuyên màng .40 Hình 3.10 Filter pore protein OsHKT2;4 hai nhóm giống lúa 41 Hình 3.11 Kết điện di kiểm tra RNA tổng số 43 Hình 3.12 Biểu đồ Association curve thể nhiệt độ gắn mồi .44 Hình 3.13 Biểu đồ Amplification curve mẫu gen OsHKT2;4 45 Hình 3.14 Đồ thị biểu mức độ thay đổi nồng độ mRNA mẫu xử lý mặn so với mẫu đối chứng giống Nipponbare (A) giống Pokkali (B) 47 DANH MỤC CÁC TỪ VIẾT TẮT HKT High-affinity Potassium Transporter DNA Deoxyribonucleic Acid RNA Ribonucleic acid cDNA Complementary Deoxyribonucleic Acid bp Basepair PCR Polymerase Chain Reaction RFLP-PCR Restriction Fragment Length Polymorphism Polymerase Chain Reaction RT-PCR Reverse Transcription Polymerase Chain Reaction dNTP Deoxy Nucleoside Triphosphate (Deoxynucleotide) ddNTP Dideoxynucleotide Fw Forward Rv Reverse Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt MỞ ĐẦU Tình hình biến đổi khí hậu giới diễn ngày phức tạp Việt Nam nƣớc chịu tác động tiêu cực nặng nề biến đổi khí hậu Với đƣờng bờ biển dài 3.260 km, với hệ thống sơng ngịi chằng chịt đổ biển qua nhiều cửa sơng, tình hình xâm nhập mặn, hệ biến đổi khí hậu ảnh hƣởng mạnh đến tình hình sản xuất nơng nghiệp nƣớc ta Ở đồng sơng Cửu Long tình hình xâm nhập mặn lấn sâu vào đất liền qua sông đến 70 km, dự báo đến tiếp tục tăng Hạn hán đất nhiễm mặn ảnh hƣởng đến 30 tỉnh thành nƣớc ta Đất nhiễm mặn gây ảnh hƣởng nghiêm trọng đến sinh trƣởng phát triển trồng, gây cân ion tích lũy Na+ Cl-, tăng cƣờng peroxide lipid, tăng sản phẩm dạng phản ứng oxy nhƣ gốc superoxide hydroxyl Để cải thiện suất điều kiện stress mặn thực vật nói chung lúa nói riêng, việc hiểu đƣợc chế phân tử đáp ứng stress mặn quan trọng Khả chịu mặn tính trạng đƣợc kiểm sốt nhiều gen Việc tìm hiểu mối liên hệ gen quan tâm khả đáp ứng với stress mặn có vai trị quan trọng lai tạo giống chịu mặn Có nhiều kênh vận chuyển màng tế bào thực vật giữ vai trị chế chống chịu mặn Trong số kênh vận chuyển Na+ K+ liên quan đến tính trạng chống chịu mặn, họ protein HKT (High-affinity potassium transporter) có vai trị quan trọng đáp ứng với stress mặn OsHKT2;4 thuộc nhóm họ protein HKT, OsHKT2;4 đƣợc biết đến với vai trò đồng vận chuyển Na+ K+ Tuy nhiên, nghiên cứu phân tử gen mã hóa cho protein OsHKT2;4 giống lúa Việt Nam cịn hạn chế Vì vậy, chúng tơi thực đề tài: “Phân tích đa hình di truyền mức độ biểu gen OsHKT2;4 lúa QH.2014.T.CH - 60420121 Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt 18 Doyle D A., Morais C J., Pfuetzner R A., Kuo A., Gulbis J M., Cohen S L., Chait B T., MacKinnon R (1998), “The structure of the potassium channel: molecular basis of K+ conduction and selectivity” Science 280, pp 69–77 19 Englund P T (1971) “Analysis of nucleotide sequences at 3’ termini of duplex deoxyribonucleic acid with the use of the T4 deoxyribonucleic acid polymerase” J biol Chem 246, pp 3269-3276 20 Englund P T (1972) “The 3’-terminal nucleotide sequences of T7 DNA” J molec Biol 66, pp 209-224 21 Fairbairn D J., Liu W., Schachtman D P., Gomez-Gallego S., Day S R., Teasdale R D (2000) Characterisation of two distinct HKT1-like potassium transporters from Eucalyptus camaldulensis” Plant Mol Biol 43, pp 515–525 22 Fink L., Seeger W., Ermert L., Hanze J., Stahl U., Grimminger F., Kummer W., Bohle R M (1998), “Real-time quantitative RT-PCR after laserassisted cell picking” Nature Medicine 4, pp 1329–1333 23 Fukuda A., Nakamura A., Tagiri A., Tanaka H., Miyao A., Hirochika H., Tanaka Y (2004), “Function, intracellular localization and the importance in salt tolerance of a vacuolar Na+/H+ antiporter from rice” Plant and Cell Physiology 45, pp 146–159 24 Galvan-Ampudia C S., et al (2013), “Halotropism is a response of plant roots to avoid a saline environment”, Curr Biol 23, pp 2044–2050 25 Garciadeblas B., Senn M E., Banuelos M A., Rodriguez-Navarro, (2003), “A Sodium transport and HKT transporters: The rice model” Plant J 34, pp 788-801 26 Gregoire C., Rémus-Borel W., Vivancos J., Labbé C., Belzile F., Bélanger R R (2012), “Discovery of a multigene family of aquaporin silicon transporters in the primitive plant Equisetum arvense” Plant J 72, pp 320–330 QH.2014.T.CH - 60420121 52 Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt 27 Griffin H G & Griffin A M (1993), “DNA sequencing - recent innovations and future trends” Appl Biochem Biotechnol 38, 147-159 28 Haferkamp I., Linka N (2012), “Functional expression and characterization of membrane transport Proteins” Plant Biol 14, pp 675–690 29 Hauser F., Horie T (2010), “A conserved primary salt tolerance mechanism K+, Mg2+, and Ca2+ Transport by OsHKT2;4 from Rice mediated by HKT transporters: a mechanism for sodium exclusion and maintenance of high K+/Na+ ratio in leaves during salinity stress” Plant Cell Environ 33, pp 552–565 30 Hedrich R (2012), “Ion channels in plants” Physiol Rev 92, pp 1777–1811 31 Horie T, Costa A, Kim TH, Han MJ, Horie R, Leung HY, Miyao A, Hirochika H, AnG, Schroeder JI (2007), “Rice OsHKT2;1 transporter mediates large Na+ influx component into K+-starved roots for growth” EMBO Journal 26, pp 3003-3014 32 Horie T., Dennis E B., Costa A., Kaneko T., Fiorella L S., Katsuhara M., Julian I S (2011), “K+ Transport by the OsHKT2;4 Transporter from Rice with Atypical Na+ Transport Properties and Competition in Permeation of K+ over Mg2+ and Ca2+ Ions”, Plant Physiology 156, pp 1493–1507 33 Jabnoune M., Espeout S., Mieulet D., Fizames C., Verdeil J L., Conejero G., Rodrıguez-Navarro A., Sentenac H., Guiderdoni E., Abdelly C (2009), “Diversity in expression patterns and functional properties in the rice HKT transporter family” Plant Physiol 150, pp 1955–1971 34 Jump S S., Michalski C W., Erkan M., Kleeff J., Friess H (2009) "Northern blot analysis for detection and quantification of RNA in pancreatic cancer cells and tissues" Nat Protoc 4(1), pp 37-43 35 Kader M A., Seidel T., Golldack D., Lindberg S (2006), “Expressions of OsHKT1, OsHKT2, and OsHVA are differentially regulated under NaCl stress in salt-sensitive and salt-tolerant rice (Oryza sativa L.) cultivars” Journal of Experimental Botany; 57, pp 4257-4268 QH.2014.T.CH - 60420121 53 Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt 36 Kazuko Y S., Kazuo S (1994), “A Novel cis-Acting Elenent in an Arabidopsis Gene Is Inviloved in Responsiveness to Drought, LowTemperature, or High-Salt Stress”, American Society of Plant Physiologists, 6, pp 251-264 37 Lan W Z., Wang W.,Wang S M., Li L G., Buchanan B B., Lin H X., Gao J P., Luan S (2010), “A rice high-affinity potassium transporter (HKT) conceals a calcium-permeable cation channel” Proc Natl Acad Sci USA 107, pp 7089–7094 38 Lu C A., Lim E K., Yu S M (1998) “Sugar response sequence in the promoter of a rice alpha-amylase gene serves as a transcriptional enhancer” J Biol Chem 273, pp 10120 39 Ma H., Chong K., Deng X W (2007) “Rice research: past, present and future” J Integr Plant Biol 49, pp 729-730 40 Maathuis F J M (2006), “The role of monovalent cation transporters in plant responses to salinity” Journal of Experimental Botany 57, pp 1137– 1147 41 Maxam A M., Gilbert W (1977), “A new method for sequencing DNA” Proc natn Acad Sci USA 74, pp 560-564 42 Mazel A., Leshem Y., Tiwari B S., Levine A (2004), “Induction of salt and osmotic stress tolerance by overexpression of an intracellular vesicle trafficking protein AtRab7 (AtRabG3e)” Plant Physiol 134, pp 118– 128 43 Marassi F M., Das B B., Lu G J., Nothnagel H.J., Park S H., Son W S., Tian Y., Opella S.J (2011), “Structure determination of membrane proteins in five easy pieces” Methods 55, pp 363–369 QH.2014.T.CH - 60420121 54 Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt 44 Muller P Y., Janovjak H., Miserez A R., Dobbie Z (2002), “Processing of gene expression data generated by quantitative real-time RTPCR” BioTechniques 32, pp 1372–1379 45 Munns R., Tester M (2008), “Mechanisms of salinity tolerance” Annu Rev Plant Biol 59, pp 651–681 46 Møller I S., Gilliham M., Jha D., Mayo G M., Roy S J., Coates J C., Haseloff J., Tester M (2009) “Shoot Na+ exclusion and increased salinity tolerance engineered by cell type-specific alteration of Na+ transport in Arabidopsis” Plant Cell 21, pp 2163–2178 47 Nugent T., Jones D T., (2012), “Membrane protein structural bioinformatics” J Struct Biol.179, pp 327–337 48 Ohgaki R., Fukura N., Matsushita M., Mitsui K., Kanazawa H (2008), “Cell surface levels of organellar Na+/H+ exchanger isoform are regulated by interaction with RACK1” J Biol Chem 283, pp 4417–4429 49 Plett D C., Møller I S (2010), “Na+ transport in glycophytic plants: What we know and would like to know” Plant Cell Environ 33, pp 612-626 50 Pyo Y J., Gierth M., Schroeder J I., Cho M H (2010), “High-affinity K+ transport in Arabidopsis: AtHAK5 and AKT1 are vital for seedling establishment and postgermination growth under low-potassium conditions” Plant Physiol 153, pp 863–875 51 Ren Z H.,(2005), “A rice quantitative trait locus for salt tolerance encodes a sodium transporter” Nat Genet 37, pp 1141-1146 52 Rengasamy P., (2006), “World salinization with emphasis on Australia” J.Exp Bot 57, pp 1017-1023 53 Richterich P (1989), “Non-radioactive chemical sequencing of biotin labeled DNA” Nucleic Acids Res 17, pp 2181-2186 QH.2014.T.CH - 60420121 55 Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt 54 Sanger F., Coulson A R (1975), “A rapid method for determining sequences in DNA by primed synthesis with DNA polymerase” J molec Biol 94, pp 441-448 55 Sanger F., Nicklen S., Coulson A R (1977) “DNA sequencing with chainterminating inhibitors” Proc natn Acad Sci USA 74, pp 5463-5467 56 Schachtman D P., Schroeder J I., (1994), “Structure and transport mechanism of a high-affinity potassium uptake transporter from higher plants” Nature 370, pp 655-658 57 Shane W., Matthew G., Maria H (2013), “Plant High-Affinity Potassium (HKT) Transporters Involved in Salinity Tolerance: Structural Insights to Probe Differences in Ion Selectivity”, Int J Mol Sci 14, pp 7660-7680 58 Sharpe R G., Hims M M., Harbach R E., Butlin R K (1999) “PCR-based methods for identification of species of the Anopheles minimus group: allele-specific amplification and single-strand conformation polymorphism”, Med Vet Entomol., 13(3), pp 265-273 59 Sunarpi H., Horie T., Motoda J., Kubo M., Yang H., Yoda K., Horie R., Chan W Y., Leung H Y., Hattori K (2005), “Enhanced salt tolerance mediated by AtHKT1 transporter-induced Na unloading from xylem vessels to xylem parenchyma cells” Plant J 44, pp 928–938 60 Takahashi N., Goto N., Okada K., Takahashi H (2002), “Hydrotropism in abscisic acid, wavy, and gravitropic mutants of Arabidopsis thaliana” Planta 216, pp 203–211 61 Wenli L., Michael O (2013), “Current analysis platforms and methods for detecting copy number variation”, Physiol Genomics, 45(1), pp 1-16 QH.2014.T.CH - 60420121 56 Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt 62 Xiayu R., Xuelin H., Zhicheng Z., Xin L (2013), “An improvement of the 2ˆ(– delta delta CT) method for quantitative real-time polymerase chain reaction data analysis”, Biostat Bioinforma Biomath, 3(3): 71–85 63 Yi S., Weigui L., Wanhuang L., Liying M., Mohammed H K (2015), “Model of Cation Transportation Mediated by High-Affinity Potassium Transporters (HKTs) in Higher Plants”, Biological Procedures Online 17(1), pp 1-13 64 Yao X., Horie T., Xue S., Leung H-Y., Katsuhara M., Brodsky D E., Wu Y., Schroeder J I (2010), “Differential sodium and potassium transport selectivities of the rice OsHKT2;1 and OsHKT2;2 transporters in plant cells” Plant Physiol 152, pp 341–355 65 Yoo S D., Cho Y H., Sheen J (2007), “Arabidopsis mesophyll protoplasts: a versatile cell system for transient gene expression analysis” Nat Protoc 2, pp 1565–1572 66 Hoa P Q., Tran X An., Trang N T N., Anh T T T., Yen H H., Van N T H., Hanh T T., Phuc D T (2016), “Investigation of polymorphisms in the coding region of OsHKT1 gene in relation to salinity in rice” Rice Science 23, pp 334-338 67 Phuc D T., Minh N V., Yen H H (2016), “Assessment of natural variation in OsHKT1;2 gene in rice (Oryza sativa)” VNU Journal of Science: Natural Sciences and Technology 32: 189-193 Tiếng Việt 68 Đặng Ngọc Hoa, Đỗ Thị Phúc (2015) “Nghiên cứu đa hình phân tích yếu tố cis thuộc vùng promoter gen OsHKT1;4 lúa” Tạp chí Khoa học, ĐHQGHN, số 31, 129-135 QH.2014.T.CH - 60420121 57 Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt 69 Đỗ Thị Phúc, Phạm Quỳnh Hoa (2016) “Nghiên cứu mức độ biểu gen OsHKT2;1 đáp ứng điều kiện mặn lúa phƣơng pháp RTPCR bán định lƣợng” Tạp chí Khoa học Cơng nghệ Việt Nam, số 2, 54-58 Website 70 https://aem.asm.org/content/64/7/2572/F1.expansion.html 71 https://learn.genetics.utah.edu/content/labs/microarray/ 72 https://learn.genetics.utah.edu/content/labs/pcr/ 73 https://pharm1.pharmazie.uni-greifswald.de/allgemei/koehler/koeh-eng.html 74 https://phytozome.jgi.doe.gov/pz/portal.html#!gene?search=1&detail=1&meth od=5017&searchText=transcriptid:33148456 75 https://thucvathoc.com/2014/04/co-che-chong-chiu-man-o-thuc-vat.html 76 https://www.appliedbiosystems.com/absite/us/en/home/applicationstechnologies/dna-sequencing-fragment-analysis/overview-of-dnasequencing/faq.html 77 https://www.biosearchtech.com/gene-expression-qpcr 78 https://www.discoveryandinnovation.com/BIOL202/notes/lecture26.html 79 https://www.ncbi.nlm.nih.gov/probe/docs/techrflp/ QH.2014.T.CH - 60420121 58 Phụ lục - Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt PHỤ LỤC Kết so sánh trình tự công cụ MultAlin QH.2014.T.CH - 60420121 s1 Phụ lục - Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt QH.2014.T.CH - 60420121 s2 Phụ lục - Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt QH.2014.T.CH - 60420121 s3 Phụ lục - Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt QH.2014.T.CH - 60420121 s4 Phụ lục - Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt QH.2014.T.CH - 60420121 s5 Phụ lục - Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt PHỤ LỤC Kết so sánh trình tự amino acid cơng cụ Clustal O CLUSTAL O(1.2.2) multiple sequence alignment Nhóm MPIRLHIFVSFARHAITSSALICRFIAFHLSPLLIHLSYFLIIDVLGFVALVMLRPSNHK 60 Nhóm MPIRLHIFVSSARHAINSSALICRFIAFHLSPLLIHLSYFLIIDVLGFVALVVLRPSNHK 60 ********** *****.***********************************:******* Nhóm YNPRYVDMFFLSTSAVTVTGLATIQMEDLSSSQIAVLTLLMFLGSEMFLSFLGLVLESSK 120 Nhóm YNPRYIDMFFLSTSAVTVTGLATTQMEDLSSSQIAVLTLLMFLGSEMFLSFLGLVLESSK 120 *****:***************** ************************************ Nhóm QNKHDPENRRVSLVTVCEQSHLEEAIPQTPSMNSTDIKRSCHKYLVFVVLAYMIIILVTG 180 Nhóm QNKHDPENRRVSSVTVCEQSHLEEAIPQTPSMNSTDIKRSCHKYLVFVVLAYMIIILVTG 180 ************ *********************************************** Nhóm SLLVFMYIAHVSSARDVLTRKSINKALFSISVTVSSFTNGGLLPTNESMAVFSSNNGLLL 240 Nhóm SLLVFMYIAHVSSARDVLTRKSINKALFSISVTVSSFTNGGLLPTNESMAVFSSNNGLLL 240 ************************************************************ Nhóm LLIGQILAGSTLFPMFLRLVIWALRGLRLAKAEEPDFMMNNSSSVGFSHLLPNLQTIFLA 300 Nhóm LLIGQILAGSTLLPMFLRLVIWALRGLRLAKAEEPDFMMNNSSSVGFSHLLPNLQTIFLA 300 ************:*********************************************** Nhóm AVEVAFVGMTVILFCCLNWDSAVFAGLTSLQKITNALFMAVNARQAGENSIDCSLVAPAA 360 Nhóm AVEVAFVGMTVILFCCLNWDSAVFAGLTSLQKITNALFMAVSARQAGENSIDCSLVAPAA 360 *****************************************.****************** Nhóm LVLFMVMMYTPSLTKLFSACQDHKQIGPESDDRTSKGKPFLKTMAFSPLAFNTTVIMLVC 420 Nhóm LVLFMVMMYTPSLTKLFSACQDHKQIGPESDDRTSKGKPFLKTMAFSPLAFNTTVIMLVC 420 ************************************************************ Nhóm ITERRSISTDPLNFSTFNIIFEVISAYGNIGLSTGYSCSRQLQHQDGIACHEKPYSFSGW 480 Nhóm ITERRSISTDPLNFSTFNIIFEVISAYGNIGLSTGYSCSRQLQHQDGIACHEKPYSFSGW 480 ************************************************************ Nhóm WSEPGKLILVLAMLYGRLNSKDSTSARTR* 509 Nhóm WSEPGKLILVLAMLYGRLNSKDSTSARTR* 509 ****************************** QH.2014.T.CH - 60420121 s6 Phụ lục - Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt PHỤ LỤC Thành phần dung dịch thủy canh Yoshida Yếu tố Cơng thức hóa học Nồng độ (ppm) Yếu tố đa lƣợng N NH4NO3 40 P NaH2PO4.2H2O 10 K KNO3 40 Ca CaCl2.2H2O 40 Mg MgSO4.7H2O 40 Yếu tố vi lƣợng Mn MnCl2.4H2O 0.50 Mo (NH4)6Mo7O24.4H2O 0.05 Zn ZnSO4.2H2O 0.01 B H3BO3 0.20 Cu CuSO4.2H2O 0.01 Fe FeCl3.6H2O 2.00 QH.2014.T.CH - 60420121 s7 Phụ lục - Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt PHỤ LỤC Chỉ số Ct mẫu tách chiết từ rễ hai giống lúa Nipponbare Pokkali NIPPONBARE Thời gian (h) Nồng độ Actin HKT2;4 mM 50 mM 100 mM mM 50 mM 100 mM 16.58 18.49 19.17 #Value #Value #Value 16.50 17.59 18.84 #Value #Value #Value 16.94 16.62 17.15 31.12 30.30 31.62 24 16.90 18.10 16.12 #Value 30.22 #Value 48 17.71 17.56 17.40 34.17 33.57 31.76 72 21.10 18.86 19.26 34.17 33.57 31.76 168 16.10 18.64 17.72 30.14 #Value #Value NaCl POKKALI 16.14 17.08 16.40 28.49 31.24 #Value 15.52 16.22 16.97 #Value 28.35 #Value 15.99 17.92 16.13 #Value #Value 35.50 24 16.09 17.38 15.56 #Value 35.85 31.68 48 16.61 19.41 19.26 #Value #Value 30.70 72 18.15 19.23 17.88 36.34 34.24 #Value 168 16.24 18.79 19.29 31.34 #Value 30.80 QH.2014.T.CH - 60420121 s8 ... tài: ? ?Phân tích đa hình di truyền mức độ biểu gen OsHKT2; 4 lúa QH.20 14. T.CH - 6 042 0121 Luận văn thạc sĩ khoa học Nguyễn Tiến Đạt (Oryza sativa)? ?? với mục tiêu: Phân tích đa hình gen OsHKT2; 4 nghiên... * * Nguyễn Tiến Đạt PHÂN TÍCH ĐA HÌNH DI TRUYỀN VÀ MỨC ĐỘ BIỂU HIỆN CỦA GEN OsHKT2; 4 Ở LÚA (Oryza sativa) Chuyên ngành : Di truyền học Mã số: 6 042 0121 LUẬN VĂN THẠC SĨ KHOA HỌC Cán... gen OsHKT2; 4 PCR 30 3.1.3 Giải trình tự gen OsHKT2; 4 31 3.1 .4 Phân tích đa hình gen OsHKT2; 4 32 3.2 Phân tích biểu gen 42 3.2.1 Kết trồng lúa thủy canh xử lý mặn 42