Investigation of suppressor of overexpression of constans 1 (SOC1) function in flowering time control of arabidopsis thaliana

Tài liệu Báo cáo khoa học: Molecular characterization of Arabidopsis thaliana PUF proteins – binding specificity and target candidates doc

Tài liệu Báo cáo khoa học: Molecular characterization of Arabidopsis thaliana PUF proteins – binding specificity and target candidates doc

... number of Arabidopsis transcripts are potential targets for regulation by the PUF family of proteins The results obtained reveal a molecular conservation of PUF proteins in Arabidopsis thaliana and ... regarding the binding specificity of the subset of group I APUM proteins, showing that A thaliana has at least six PUF proteins with conserved RNA -binding...

Ngày tải lên: 18/02/2014, 06:20

15 586 0
Tài liệu Báo cáo khoa học: Characterization of the interaction between the plasma membrane H+-ATPase of Arabidopsis thaliana and a novel interactor (PPI1) doc

Tài liệu Báo cáo khoa học: Characterization of the interaction between the plasma membrane H+-ATPase of Arabidopsis thaliana and a novel interactor (PPI1) doc

... (2002) A novel interaction partner for the C-terminus of Arabidopsis thaliana plasma membrane H+-ATPase (AHA1 isoform): site and mechanism of action on H+-ATPase activity differ from those of 14-3-3 ... Rasi-Caldogno F (1998) Fusicoccin binding to its plasma membrane receptor and the activation of the plasma membrane H+-ATPase IV Fusicoccin induce...

Ngày tải lên: 19/02/2014, 07:20

8 629 0
Báo cáo khoa học: Hydroperoxide reduction by thioredoxin-specific glutathione peroxidase isoenzymes of Arabidopsis thaliana potx

Báo cáo khoa học: Hydroperoxide reduction by thioredoxin-specific glutathione peroxidase isoenzymes of Arabidopsis thaliana potx

... al A thaliana glutathione peroxidases Detection of enzyme activities of GPX isoenzymes When the recombinant AtGPX isoenzymes were used with GSH or NADPH as a reducing agent and H2O2, cumene hydroperoxide, ... A thaliana glutathione peroxidases A Iqbal et al Table Comparison of kinetic characteristics of Arabidopsis, tomato and sunflower GPX isoenzymes towards thioredoxi...

Ngày tải lên: 16/03/2014, 12:20

9 414 0
Báo cáo khoa học: The three typical aspartic proteinase genes of Arabidopsis thaliana are differentially expressed docx

Báo cáo khoa học: The three typical aspartic proteinase genes of Arabidopsis thaliana are differentially expressed docx

... comparison of several plant aspartic proteinase genes with the human cathepsin D gene The top line of the figure shows the arrangement of the functional regions of the plant aspartic proteinase genes ... whether the aspartic proteinase genes are also expressed in the guard cells of leaves; if so, this could explain the greater expression of...

Ngày tải lên: 17/03/2014, 11:20

10 250 0
Báo cáo khoa học: Purification and kinetic analysis of the two recombinant arogenate dehydrogenase isoforms of Arabidopsis thaliana pptx

Báo cáo khoa học: Purification and kinetic analysis of the two recombinant arogenate dehydrogenase isoforms of Arabidopsis thaliana pptx

... TyrAAT2 and each of the two peptide domains of TyrAAT1 revealed more than 50% identity in the two cases (Fig 2B) Purication of TyrAAT1 and TyrAAT2 The two recombinant isoforms of A thaliana arogenate ... understanding the partition of the carbon ux between the different end products The present study is the rst to report the purication and detai...

Ngày tải lên: 17/03/2014, 11:20

9 429 0
Báo cáo khoa học: A hydrophilic cation-binding protein of Arabidopsis thaliana, AtPCaP1, is localized to plasma membrane via N-myristoylation and interacts with calmodulin and the phosphatidylinositol phosphates PtdIns(3,4,5)P3 and PtdIns(3,5)P2 pptx

Báo cáo khoa học: A hydrophilic cation-binding protein of Arabidopsis thaliana, AtPCaP1, is localized to plasma membrane via N-myristoylation and interacts with calmodulin and the phosphatidylinositol phosphates PtdIns(3,4,5)P3 and PtdIns(3,5)P2 pptx

... of PCaP1 orthologous protein in crude membrane fractions with anti-PCaP1 Lanes and 6, A thaliana; lanes and 7, Raphanus sativus; lanes and 8, Brassica rapa; lanes and 9, B rapa var glabra; lanes ... that the N-terminal part with 27 residues has the ability to localize the protein to the plasma membrane, and that Gly2 is essential for plasma membrane...

Ngày tải lên: 23/03/2014, 07:20

16 424 0
Báo cáo khoa học: The allene oxide cyclase family of Arabidopsis thaliana – localization and cyclization ppt

Báo cáo khoa học: The allene oxide cyclase family of Arabidopsis thaliana – localization and cyclization ppt

... biosynthesis and the allene oxide cyclase family of Arabidopsis thaliana Plant Mol Biol 51, 89 5–9 11 23 Hofmann E, Zerbe P & Schaller F (2006) The crystal structure of Arabidopsis thaliana allene oxide ... nature of the side chains of Asn and Leu and steric constraints imposed by the two methyl groups of Leu on the substrate The finding that...

Ngày tải lên: 23/03/2014, 07:20

14 366 0
Báo cáo khoa học: Cloning and functional characterization of Arabidopsis thaliana D-amino acid aminotransferase – D-aspartate behavior during germination pdf

Báo cáo khoa học: Cloning and functional characterization of Arabidopsis thaliana D-amino acid aminotransferase – D-aspartate behavior during germination pdf

... appearance of other d-amino acids This is the first report, for eukaryotes, of cDNA cloning and functional characterization of d-AAT acid aminotransferase in A thaliana tion rate of main roots and hypocotyls ... between d-amino acids, was cloned and characterized This represents the first cDNA cloning and functional characterization of a d-AAT of eukary...

Ngày tải lên: 30/03/2014, 04:20

13 401 0
Báo cáo khoa học: Light regulation of CaS, a novel phosphoprotein in the thylakoid membrane of Arabidopsis thaliana doc

Báo cáo khoa học: Light regulation of CaS, a novel phosphoprotein in the thylakoid membrane of Arabidopsis thaliana doc

... 5¢-AAATGGCAACGAAGTCTTCAC-3¢ and 5¢-CAGTCGGAGCTAGGAAGGAA-3¢ Isolation of plasma membrane, intact chloroplasts, stroma and thylakoids The plasma membrane fraction of Arabidopsis was isolated as ... is a crucial component of the protein phosphorylation cascade involved in CaS phosphorylation Characterization of the CaS mutant lines The mutant Arabidopsis lines with T-D...

Ngày tải lên: 30/03/2014, 04:20

11 446 0
Báo cáo khoa học: Detection of nucleolar organizer and mitochondrial DNA insertion regions based on the isochore map of Arabidopsis thaliana ppt

Báo cáo khoa học: Detection of nucleolar organizer and mitochondrial DNA insertion regions based on the isochore map of Arabidopsis thaliana ppt

... structures Most of the regions have large fluctuations, indicating the GC content is inhomogeneous in these regions Therefore, they are called isochore- like regions in this paper Some regions are approximately ... GC-rich isochore- like regions Because the gene density in centromere regions is much lower than that of other regions, the higher GC content in the centrom...

Ngày tải lên: 30/03/2014, 20:20

9 523 0
Báo cáo Y học: Histidine mutagenesis of Arabidopsis thaliana pyruvate dehydrogenase kinase ppt

Báo cáo Y học: Histidine mutagenesis of Arabidopsis thaliana pyruvate dehydrogenase kinase ppt

... -LDGHNEG-VTMAGYGYGIPISRLYAR IKMSDRGGGVPLRRIERLFSYMYSTAPTPQPGTGG -TPLAGFGYGLPISRLYAK IKISDRGGGVSRTILDRLFTYMYSTAPPPPRDGTQPP -LAGYGYGLPLSRLYAR IK+SD GGG+ R+ L RIFTY+YSTA P +AGYGYGLPISRLYAR G1-box G2-box YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP ... YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP YFGGDLQIISMEGYGTDAYLHL-SRLGDSEEPLP YFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHHYQTIQEAGDWCVPSTE YFHGDMYLVSMEGYGTDAMIFLKAI...

Ngày tải lên: 31/03/2014, 15:20

6 368 0
Báo cáo hóa học: " Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus" potx

Báo cáo hóa học: " Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus" potx

... At5g59780), the ninth one (At5g59430) corresponds to the telomeric repeat-binding protein (TRP1), which also contains the typical MYB motifs [26] Eight out of these nine genes were also included in the ... defense-related genes One of these over-expressed genes was PAD4, which is involved in signaling during plant defense responses This gene was also shown to be over-express...

Ngày tải lên: 20/06/2014, 01:20

11 436 0
báo cáo khoa học: " Induction of stromule formation by extracellular sucrose and glucose in epidermal leaf tissue of Arabidopsis thaliana" pot

báo cáo khoa học: " Induction of stromule formation by extracellular sucrose and glucose in epidermal leaf tissue of Arabidopsis thaliana" pot

... possible involvement of stromules in carbohydrate metabolism This supports the idea of stromules being involved in optimizing metabolite exchange The stromule inducing capacity of glucose and sucrose, ... as model tissue, we addressed the influence of extracellular sugars on stromule formation Stromule formation is specifically induced by sucrose and gluco...

Ngày tải lên: 11/08/2014, 11:21

10 584 0
Crystal structure of arabidopsis thaliana cyclophilin 38 (atcyp38 1

Crystal structure of arabidopsis thaliana cyclophilin 38 (atcyp38 1

... problem 15 1. 4 GEOMETRIC DATA COLLECTION 16 1. 4 .1 Data reduction 17 iv 1. 5 STRUCTURE DETERMINATION 18 1. 5 .1 Phasing methods 18 1. 5 .1. 1 The Multi-wavelength anomalous dispersion (MAD) method 21 1.5 .1. 2 ... PSBQ 10 8 4 .11 FUTURE DIRECTIONS 11 3 4 .12 CONCLUDING REMARKS 11 3 REFERENCES 11 5 viii SUMMARY Cyclophilin 38 (CyP38) is one of the highly divergent mu...

Ngày tải lên: 14/09/2015, 17:52

95 176 0
Investigation of suppressor of overexpression of constans 1 (SOC1) function in flowering time control of arabidopsis thaliana

Investigation of suppressor of overexpression of constans 1 (SOC1) function in flowering time control of arabidopsis thaliana

... Arabidopsis thaliana 2.6 Previous research on SUPPRESSOR OF CO OVEREXPRESSION 18 (SOC1) 2.6 .1 SOC1 is a flowering promoter in Arabidopsis 18 2.6.2 SOC1 integrates all the four flowering pathways in 19 Arabidopsis ... Investigation of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS (SOC1) Function in Flowering Time Control of Arabidopsis...

Ngày tải lên: 08/11/2015, 17:01

107 276 0
w